Vicugna pacos (alpaca): 102526223 Help Entry 102526223         CDS       T08098                                  Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism vpc  Vicugna pacos (alpaca) Pathway vpc04613   Neutrophil extracellular trap formation vpc05034   Alcoholism vpc05202   Transcriptional misregulation in cancer vpc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:vpc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102526223  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102526223   09163 Immune disease    05322 Systemic lupus erythematosus     102526223   09165 Substance dependence    05034 Alcoholism     102526223  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vpc03036]     102526223   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vpc04147]     102526223 Chromosome and associated proteins [BR:vpc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102526223 Exosome [BR:vpc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102526223 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  102526223 NCBI-ProteinID:  XP_006198891 UniProt:  A0A6J3BKV2 LinkDB All DBs Position 23 AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagaccgcccgcaaatcgaccggtggtaaagcaccgaggaagcaa ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtaccgtggcactccgtgaaattagacgttatcagaagtccactgaa cttctgattcgcaaacttcccttccagcgtctggtgcgggaaattgctcaggacttcaaa acagatctgcgcttccagagtgcggctattggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system