Vicugna pacos (alpaca): 102526809 Help Entry 102526809         CDS       T08098                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism vpc  Vicugna pacos (alpaca) Pathway vpc04010   MAPK signaling pathway vpc04014   Ras signaling pathway vpc04015   Rap1 signaling pathway vpc04024   cAMP signaling pathway vpc04072   Phospholipase D signaling pathway vpc04137   Mitophagy - animal vpc04140   Autophagy - animal vpc04218   Cellular senescence vpc04360   Axon guidance vpc04371   Apelin signaling pathway vpc04519   Cadherin signaling vpc04625   C-type lectin receptor signaling pathway vpc04810   Regulation of actin cytoskeleton vpc05132   Salmonella infection vpc05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:vpc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102526809 (RRAS)    04014 Ras signaling pathway     102526809 (RRAS)    04015 Rap1 signaling pathway     102526809 (RRAS)    04371 Apelin signaling pathway     102526809 (RRAS)    04072 Phospholipase D signaling pathway     102526809 (RRAS)    04024 cAMP signaling pathway     102526809 (RRAS)   09133 Signaling molecules and interaction    04519 Cadherin signaling     102526809 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102526809 (RRAS)    04137 Mitophagy - animal     102526809 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     102526809 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102526809 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102526809 (RRAS)   09158 Development and regeneration    04360 Axon guidance     102526809 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102526809 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     102526809 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:vpc04031]     102526809 (RRAS) GTP-binding proteins [BR:vpc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102526809 (RRAS) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_22 Motif Other DBs NCBI-GeneID:  102526809 NCBI-ProteinID:  XP_031537906 UniProt:  A0A6J3AZH6 LinkDB All DBs Position 11 AA seq 218 aa AA seqDB search MSTGAASGTGRGRPRGGGPGPGDPPPNETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICTVDGVPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVS KLFTQILRVKDRDDFPIVLVGNKADLETQRQVPRSEASAFSASHHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPSPPSAPRKKDGGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcaccggggcggcgtccgggacggggcgggggcggccccggggcggggggccgggg cccggggaccccccacccaacgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcgctgaccatccagttcatccagtcctacttcgtgtctgactacgatccc actattgaagactcctacacgaagatctgcacagtggatggcgtcccggcccggcttgac atcctggacaccgcaggccaggaggagtttggtgccatgagggagcagtacatgcgcgcg ggccacggcttcctgctggtgtttgccattaatgaccggcagagtttcaacgaggtgagc aagctcttcacgcagatcctcagagtcaaggacagagatgacttccccatcgtgttagtc gggaacaaggcagatctggagacacagcgccaggttccccgatcggaagcctccgccttc agcgcctcccaccatgtggcctactttgaggcgtcggccaaactgcgcctcaacgtggat gaggccttcgagcagctggtgcgggcagtccggaagtaccaggaacaagagctcccgccc agcccccccagtgcccccaggaagaaggatgggggctgcccctgcgtcctcctgtag

DBGET integrated database retrieval system