Vicugna pacos (alpaca): 102527036 Help Entry 102527036         CDS       T08098                                  Symbol GHRH Name (RefSeq) somatoliberin   KO K05260   growth hormone-releasing hormone Organism vpc  Vicugna pacos (alpaca) Pathway vpc04080   Neuroactive ligand-receptor interaction vpc04081   Hormone signaling vpc04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:vpc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102527036 (GHRH)    04081 Hormone signaling     102527036 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     102527036 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vpc04052]     102527036 (GHRH) Cytokines and neuropeptides [BR:vpc04052]  Neuropeptides   GPCR binding    102527036 (GHRH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 Motif Other DBs NCBI-GeneID:  102527036 NCBI-ProteinID:  XP_006202625 UniProt:  A0A6I9I667 LinkDB All DBs Position 19 AA seq 114 aa AA seqDB search MLLWVVFLVTLTLSSGSHGSPPSQPLRMPRYADAIFTNSYRKVLGQLSALRLLQGIMSKQ QGERNQEQGARVRAGRQVDGVWADQKQMVLESTLWPCCSSTGIPKGEDSACVLC NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgctgctctgggtggtcttcctcgtgaccctcaccctcagcagcggctcccacggttcc ccaccctcccagcccctcaggatgccgcggtacgcagatgccatcttcaccaatagctac cggaaggtgctgggccagctgtctgccctcaggctgctccagggcatcatgagcaaacag cagggagagagaaaccaggagcaaggagcaagggtacgggctggccgtcaggtggacggt gtgtgggcagaccaaaagcagatggtattggagagcaccctgtggccctgctgcagcagc acaggaattcccaagggtgaagattctgcctgtgttctctgctag

DBGET integrated database retrieval system