Vicugna pacos (alpaca): 102527210 Help Entry 102527210         CDS       T08098                                  Symbol ARHGDIG Name (RefSeq) rho GDP-dissociation inhibitor 3   KO K12462   Rho GDP-dissociation inhibitor Organism vpc  Vicugna pacos (alpaca) Pathway vpc04722   Neurotrophin signaling pathway vpc04962   Vasopressin-regulated water reabsorption Brite KEGG Orthology (KO) [BR:vpc00001]  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     102527210 (ARHGDIG)   09156 Nervous system    04722 Neurotrophin signaling pathway     102527210 (ARHGDIG)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vpc04147]     102527210 (ARHGDIG) Exosome [BR:vpc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102527210 (ARHGDIG)   Exosomal proteins of other body fluids (saliva and urine)    102527210 (ARHGDIG)   Exosomal proteins of colorectal cancer cells    102527210 (ARHGDIG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Rho_GDI Motif Other DBs NCBI-GeneID:  102527210 NCBI-ProteinID:  XP_031543042 UniProt:  A0A6J3BCR4 LinkDB All DBs Position 18 AA seq 127 aa AA seqDB search MSEQAPGPIIMDLTGELAALKNQVFVLKEGVDYKVKITFKVNKEIVSGLKCLHHTYRRGL RVDKAVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGTYVVTSFITDDDRTPHLSWEWGLH IRQDWEN NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgtctgagcaggctccagggcccatcatcatggacctaacaggggagttggctgcgctg aaaaaccaggtgtttgtcctgaaggagggtgttgattacaaagtgaagattaccttcaag gtcaacaaggagattgtcagtggcctcaagtgtctgcatcacacctaccgccggggcctg cgcgtggacaaagctgtctacatggtgggcagttacggcccgagcgcccaggagtatgag ttcgtgactccggtggaggaggcaccccggggcgccctggtgcggggcacctacgtggtc acgtccttcatcaccgatgacgacaggacccctcacctgtcctgggaatggggcctccac atccggcaggactgggagaactga

DBGET integrated database retrieval system