Vicugna pacos (alpaca): 102527239 Help Entry 102527239         CDS       T08098                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism vpc  Vicugna pacos (alpaca) Pathway vpc04613   Neutrophil extracellular trap formation vpc05034   Alcoholism vpc05202   Transcriptional misregulation in cancer vpc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:vpc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102527239  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102527239   09163 Immune disease    05322 Systemic lupus erythematosus     102527239   09165 Substance dependence    05034 Alcoholism     102527239  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vpc03036]     102527239   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vpc04147]     102527239 Chromosome and associated proteins [BR:vpc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102527239 Exosome [BR:vpc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102527239 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S Motif Other DBs NCBI-GeneID:  102527239 NCBI-ProteinID:  XP_006210305 UniProt:  A0A6I9IF10 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MAGTQQTARKSTSGKAPSKQLATKAARKSAPSTGGMKKPHHYRPGTVALHEIRHYQKSTE LLIRKLPFQRLVWEIAQDLKTDLRFQSAAIGALQEASEAYLVGLFEDTNLRAIHAQCITI MPKDIQLACRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctggtacacagcagactgcccgcaaatcaaccagtggtaaagcaccaagtaagcaa ctggctacaaaagccgctcgcaagagtgcaccctctactggagggatgaagaaacctcat cattacaggcctggtaccgtggcacttcacgaaattagacattatcagaagtccactgaa cttctgattcgcaaacttcccttccagcgactggtgtgggaaattgctcaggacttaaaa acagatctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagacaccaacttacgtgctatccatgcccaatgtataacaatt atgccaaaagacatccagctagcatgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system