KEGG   Vicugna pacos (alpaca): 102528720
Entry
102528720         CDS       T08098                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
vpc  Vicugna pacos (alpaca)
Pathway
vpc01521  EGFR tyrosine kinase inhibitor resistance
vpc01522  Endocrine resistance
vpc01524  Platinum drug resistance
vpc04010  MAPK signaling pathway
vpc04012  ErbB signaling pathway
vpc04014  Ras signaling pathway
vpc04015  Rap1 signaling pathway
vpc04022  cGMP-PKG signaling pathway
vpc04024  cAMP signaling pathway
vpc04062  Chemokine signaling pathway
vpc04066  HIF-1 signaling pathway
vpc04068  FoxO signaling pathway
vpc04071  Sphingolipid signaling pathway
vpc04072  Phospholipase D signaling pathway
vpc04114  Oocyte meiosis
vpc04140  Autophagy - animal
vpc04148  Efferocytosis
vpc04150  mTOR signaling pathway
vpc04151  PI3K-Akt signaling pathway
vpc04210  Apoptosis
vpc04218  Cellular senescence
vpc04261  Adrenergic signaling in cardiomyocytes
vpc04270  Vascular smooth muscle contraction
vpc04350  TGF-beta signaling pathway
vpc04360  Axon guidance
vpc04370  VEGF signaling pathway
vpc04371  Apelin signaling pathway
vpc04380  Osteoclast differentiation
vpc04510  Focal adhesion
vpc04517  IgSF CAM signaling
vpc04520  Adherens junction
vpc04540  Gap junction
vpc04550  Signaling pathways regulating pluripotency of stem cells
vpc04611  Platelet activation
vpc04613  Neutrophil extracellular trap formation
vpc04620  Toll-like receptor signaling pathway
vpc04621  NOD-like receptor signaling pathway
vpc04625  C-type lectin receptor signaling pathway
vpc04650  Natural killer cell mediated cytotoxicity
vpc04657  IL-17 signaling pathway
vpc04658  Th1 and Th2 cell differentiation
vpc04659  Th17 cell differentiation
vpc04660  T cell receptor signaling pathway
vpc04662  B cell receptor signaling pathway
vpc04664  Fc epsilon RI signaling pathway
vpc04666  Fc gamma R-mediated phagocytosis
vpc04668  TNF signaling pathway
vpc04713  Circadian entrainment
vpc04720  Long-term potentiation
vpc04722  Neurotrophin signaling pathway
vpc04723  Retrograde endocannabinoid signaling
vpc04724  Glutamatergic synapse
vpc04725  Cholinergic synapse
vpc04726  Serotonergic synapse
vpc04730  Long-term depression
vpc04810  Regulation of actin cytoskeleton
vpc04910  Insulin signaling pathway
vpc04912  GnRH signaling pathway
vpc04914  Progesterone-mediated oocyte maturation
vpc04915  Estrogen signaling pathway
vpc04916  Melanogenesis
vpc04917  Prolactin signaling pathway
vpc04919  Thyroid hormone signaling pathway
vpc04921  Oxytocin signaling pathway
vpc04926  Relaxin signaling pathway
vpc04928  Parathyroid hormone synthesis, secretion and action
vpc04929  GnRH secretion
vpc04930  Type II diabetes mellitus
vpc04933  AGE-RAGE signaling pathway in diabetic complications
vpc04934  Cushing syndrome
vpc04935  Growth hormone synthesis, secretion and action
vpc04960  Aldosterone-regulated sodium reabsorption
vpc05010  Alzheimer disease
vpc05020  Prion disease
vpc05022  Pathways of neurodegeneration - multiple diseases
vpc05034  Alcoholism
vpc05132  Salmonella infection
vpc05133  Pertussis
vpc05135  Yersinia infection
vpc05140  Leishmaniasis
vpc05142  Chagas disease
vpc05145  Toxoplasmosis
vpc05152  Tuberculosis
vpc05160  Hepatitis C
vpc05161  Hepatitis B
vpc05163  Human cytomegalovirus infection
vpc05164  Influenza A
vpc05165  Human papillomavirus infection
vpc05166  Human T-cell leukemia virus 1 infection
vpc05167  Kaposi sarcoma-associated herpesvirus infection
vpc05170  Human immunodeficiency virus 1 infection
vpc05171  Coronavirus disease - COVID-19
vpc05200  Pathways in cancer
vpc05203  Viral carcinogenesis
vpc05205  Proteoglycans in cancer
vpc05206  MicroRNAs in cancer
vpc05207  Chemical carcinogenesis - receptor activation
vpc05208  Chemical carcinogenesis - reactive oxygen species
vpc05210  Colorectal cancer
vpc05211  Renal cell carcinoma
vpc05212  Pancreatic cancer
vpc05213  Endometrial cancer
vpc05214  Glioma
vpc05215  Prostate cancer
vpc05216  Thyroid cancer
vpc05218  Melanoma
vpc05219  Bladder cancer
vpc05220  Chronic myeloid leukemia
vpc05221  Acute myeloid leukemia
vpc05223  Non-small cell lung cancer
vpc05224  Breast cancer
vpc05225  Hepatocellular carcinoma
vpc05226  Gastric cancer
vpc05230  Central carbon metabolism in cancer
vpc05231  Choline metabolism in cancer
vpc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
vpc05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vpc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102528720 (MAPK1)
   04012 ErbB signaling pathway
    102528720 (MAPK1)
   04014 Ras signaling pathway
    102528720 (MAPK1)
   04015 Rap1 signaling pathway
    102528720 (MAPK1)
   04350 TGF-beta signaling pathway
    102528720 (MAPK1)
   04370 VEGF signaling pathway
    102528720 (MAPK1)
   04371 Apelin signaling pathway
    102528720 (MAPK1)
   04668 TNF signaling pathway
    102528720 (MAPK1)
   04066 HIF-1 signaling pathway
    102528720 (MAPK1)
   04068 FoxO signaling pathway
    102528720 (MAPK1)
   04072 Phospholipase D signaling pathway
    102528720 (MAPK1)
   04071 Sphingolipid signaling pathway
    102528720 (MAPK1)
   04024 cAMP signaling pathway
    102528720 (MAPK1)
   04022 cGMP-PKG signaling pathway
    102528720 (MAPK1)
   04151 PI3K-Akt signaling pathway
    102528720 (MAPK1)
   04150 mTOR signaling pathway
    102528720 (MAPK1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    102528720 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102528720 (MAPK1)
   04148 Efferocytosis
    102528720 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102528720 (MAPK1)
   04210 Apoptosis
    102528720 (MAPK1)
   04218 Cellular senescence
    102528720 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102528720 (MAPK1)
   04520 Adherens junction
    102528720 (MAPK1)
   04540 Gap junction
    102528720 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102528720 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102528720 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102528720 (MAPK1)
   04613 Neutrophil extracellular trap formation
    102528720 (MAPK1)
   04620 Toll-like receptor signaling pathway
    102528720 (MAPK1)
   04621 NOD-like receptor signaling pathway
    102528720 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    102528720 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    102528720 (MAPK1)
   04660 T cell receptor signaling pathway
    102528720 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    102528720 (MAPK1)
   04659 Th17 cell differentiation
    102528720 (MAPK1)
   04657 IL-17 signaling pathway
    102528720 (MAPK1)
   04662 B cell receptor signaling pathway
    102528720 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    102528720 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    102528720 (MAPK1)
   04062 Chemokine signaling pathway
    102528720 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102528720 (MAPK1)
   04929 GnRH secretion
    102528720 (MAPK1)
   04912 GnRH signaling pathway
    102528720 (MAPK1)
   04915 Estrogen signaling pathway
    102528720 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    102528720 (MAPK1)
   04917 Prolactin signaling pathway
    102528720 (MAPK1)
   04921 Oxytocin signaling pathway
    102528720 (MAPK1)
   04926 Relaxin signaling pathway
    102528720 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    102528720 (MAPK1)
   04919 Thyroid hormone signaling pathway
    102528720 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    102528720 (MAPK1)
   04916 Melanogenesis
    102528720 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102528720 (MAPK1)
   04270 Vascular smooth muscle contraction
    102528720 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102528720 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102528720 (MAPK1)
   04725 Cholinergic synapse
    102528720 (MAPK1)
   04726 Serotonergic synapse
    102528720 (MAPK1)
   04720 Long-term potentiation
    102528720 (MAPK1)
   04730 Long-term depression
    102528720 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    102528720 (MAPK1)
   04722 Neurotrophin signaling pathway
    102528720 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    102528720 (MAPK1)
   04380 Osteoclast differentiation
    102528720 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102528720 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102528720 (MAPK1)
   05206 MicroRNAs in cancer
    102528720 (MAPK1)
   05205 Proteoglycans in cancer
    102528720 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    102528720 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    102528720 (MAPK1)
   05203 Viral carcinogenesis
    102528720 (MAPK1)
   05230 Central carbon metabolism in cancer
    102528720 (MAPK1)
   05231 Choline metabolism in cancer
    102528720 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102528720 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102528720 (MAPK1)
   05212 Pancreatic cancer
    102528720 (MAPK1)
   05225 Hepatocellular carcinoma
    102528720 (MAPK1)
   05226 Gastric cancer
    102528720 (MAPK1)
   05214 Glioma
    102528720 (MAPK1)
   05216 Thyroid cancer
    102528720 (MAPK1)
   05221 Acute myeloid leukemia
    102528720 (MAPK1)
   05220 Chronic myeloid leukemia
    102528720 (MAPK1)
   05218 Melanoma
    102528720 (MAPK1)
   05211 Renal cell carcinoma
    102528720 (MAPK1)
   05219 Bladder cancer
    102528720 (MAPK1)
   05215 Prostate cancer
    102528720 (MAPK1)
   05213 Endometrial cancer
    102528720 (MAPK1)
   05224 Breast cancer
    102528720 (MAPK1)
   05223 Non-small cell lung cancer
    102528720 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102528720 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    102528720 (MAPK1)
   05161 Hepatitis B
    102528720 (MAPK1)
   05160 Hepatitis C
    102528720 (MAPK1)
   05171 Coronavirus disease - COVID-19
    102528720 (MAPK1)
   05164 Influenza A
    102528720 (MAPK1)
   05163 Human cytomegalovirus infection
    102528720 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102528720 (MAPK1)
   05165 Human papillomavirus infection
    102528720 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102528720 (MAPK1)
   05135 Yersinia infection
    102528720 (MAPK1)
   05133 Pertussis
    102528720 (MAPK1)
   05152 Tuberculosis
    102528720 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102528720 (MAPK1)
   05140 Leishmaniasis
    102528720 (MAPK1)
   05142 Chagas disease
    102528720 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102528720 (MAPK1)
   05020 Prion disease
    102528720 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    102528720 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    102528720 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102528720 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102528720 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102528720 (MAPK1)
   04934 Cushing syndrome
    102528720 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102528720 (MAPK1)
   01524 Platinum drug resistance
    102528720 (MAPK1)
   01522 Endocrine resistance
    102528720 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vpc01001]
    102528720 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:vpc03036]
    102528720 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vpc04147]
    102528720 (MAPK1)
Enzymes [BR:vpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102528720 (MAPK1)
Protein kinases [BR:vpc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102528720 (MAPK1)
Chromosome and associated proteins [BR:vpc03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     102528720 (MAPK1)
Exosome [BR:vpc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102528720 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo Kinase-like
Other DBs
NCBI-GeneID: 102528720
NCBI-ProteinID: XP_006213368
LinkDB
Position
Unknown
AA seq 329 aa
MNTVKYCASSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIR
APTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLK
PSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDI
WSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKN
KVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKF
DMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 990 nt   +upstreamnt  +downstreamnt
atgaacactgtcaagtactgtgctagctctgcctatgataatgtcaacaaagtccgagtc
gctatcaagaaaatcagtccttttgagcaccagacctactgccagagaaccctgagggag
atcaaaatcctgctgcgcttcagacacgagaacatcatcgggatcaatgacatcattcga
gcaccaaccatcgagcagatgaaggatgtatacatagtacaggacctcatggagacagat
ctctacaagctcttgaagacacagcacctcagcaatgaccatatctgctattttctctac
cagatcctcagagggcttaaatatatccattcagctaacgtgctgcaccgtgacctcaag
ccttccaacctgctgctcaacaccacctgcgatctcaagatctgtgactttggtttggcc
cgtgttgcggatccggaccatgaccacacagggttcctgacggagtacgtagccacgcgc
tggtaccgggctccggaaattatgttaaattccaagggctacaccaagtccattgacatt
tggtctgtaggctgcatcctggcagagatgctctccaacaggcccatcttcccggggaag
cactatctcgaccagctgaaccacattctgggtattctcggatccccgtcacaggaagac
ctgaactgtattataaatttaaaagctagaaactacttgctttctcttccacacaaaaat
aaggtgccgtggaacaggctgttcccaaatgctgactccaaagctctggatctactggac
aagatgctgacattcaacccccacaagaggattgaagtggagcaggctctggcccacccg
tacctggagcagtactatgacccaagtgacgagcccatcgctgaagcaccgttcaagttt
gacatggagttggatgatttgcccaaggagaagctcaaagaactcatttttgaggagacc
gctagattccagccaggatacagatcttaa

DBGET integrated database retrieval system