Vicugna pacos (alpaca): 102529392 Help Entry 102529392         CDS       T08098                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism vpc  Vicugna pacos (alpaca) Pathway vpc04060   Cytokine-cytokine receptor interaction vpc04061   Viral protein interaction with cytokine and cytokine receptor vpc04062   Chemokine signaling pathway vpc04620   Toll-like receptor signaling pathway vpc04621   NOD-like receptor signaling pathway vpc04623   Cytosolic DNA-sensing pathway vpc04668   TNF signaling pathway vpc05020   Prion disease vpc05142   Chagas disease vpc05163   Human cytomegalovirus infection vpc05164   Influenza A vpc05168   Herpes simplex virus 1 infection vpc05323   Rheumatoid arthritis vpc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:vpc00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     102529392 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102529392 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     102529392 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102529392 (CCL5)    04621 NOD-like receptor signaling pathway     102529392 (CCL5)    04623 Cytosolic DNA-sensing pathway     102529392 (CCL5)    04062 Chemokine signaling pathway     102529392 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     102529392 (CCL5)    05168 Herpes simplex virus 1 infection     102529392 (CCL5)    05163 Human cytomegalovirus infection     102529392 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     102529392 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     102529392 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     102529392 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102529392 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vpc04052]     102529392 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:vpc00536]     102529392 (CCL5) Cytokines and neuropeptides [BR:vpc04052]  Cytokines   Chemokines    102529392 (CCL5) Glycosaminoglycan binding proteins [BR:vpc00536]  Heparan sulfate / Heparin   Chemokines    102529392 (CCL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  102529392 NCBI-ProteinID:  XP_006219261 UniProt:  A0A6J3B6Y6 LinkDB All DBs Position 16 AA seq 91 aa AA seqDB search MKVSTAVLAVILAAATLCVPASASPYASDTTPCCFAYISRPLPRAHIHEYFYTSSKCSMA AVVFITRKNRQVCADPEKKWVREYINSLELS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccactgcggtcctcgccgtcatcctcgccgctgccaccctctgcgtgcct gcgtctgcctccccatatgcctcggacaccacaccctgctgctttgcctacatctcccgc ccgctgccccgcgcccacatccacgagtatttctacaccagcagcaagtgctccatggca gcagtcgtctttatcaccagaaagaaccgccaggtgtgcgccgacccagagaagaaatgg gtgcgggagtacatcaactctttggagttgagctag

DBGET integrated database retrieval system