Vicugna pacos (alpaca): 102531330 Help Entry 102531330         CDS       T08098                                  Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism vpc  Vicugna pacos (alpaca) Pathway vpc04978   Mineral absorption Brite KEGG Orthology (KO) [BR:vpc00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     102531330  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:vpc03019]     102531330    03029 Mitochondrial biogenesis [BR:vpc03029]     102531330 Messenger RNA biogenesis [BR:vpc03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      102531330 Mitochondrial biogenesis [BR:vpc03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     102531330 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  102531330 NCBI-ProteinID:  XP_006214597 UniProt:  A0A6I9IKM6 LinkDB All DBs Position 9 AA seq 61 aa AA seqDB search MDPNCSCSSGDSCSCPGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggatcctaactgctcctgctcctccggtgactcctgctcgtgtcctggctcctgtaaa tgcaaagagtgcaaatgcacctcctgcaagaagagttgctgctcctgctgcccagtgggc tgtgccaagtgcgcccagggctgcatctgcaaaggggcgtcggacaagtgcagctgctgt gcctga

DBGET integrated database retrieval system