Vicugna pacos (alpaca): 102533127 Help Entry 102533127         CDS       T08098                                  Symbol CXCL8 Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism vpc  Vicugna pacos (alpaca) Pathway vpc04060   Cytokine-cytokine receptor interaction vpc04061   Viral protein interaction with cytokine and cytokine receptor vpc04062   Chemokine signaling pathway vpc04064   NF-kappa B signaling pathway vpc04072   Phospholipase D signaling pathway vpc04218   Cellular senescence vpc04620   Toll-like receptor signaling pathway vpc04621   NOD-like receptor signaling pathway vpc04622   RIG-I-like receptor signaling pathway vpc04657   IL-17 signaling pathway vpc04932   Non-alcoholic fatty liver disease vpc04933   AGE-RAGE signaling pathway in diabetic complications vpc04936   Alcoholic liver disease vpc05132   Salmonella infection vpc05133   Pertussis vpc05134   Legionellosis vpc05135   Yersinia infection vpc05142   Chagas disease vpc05144   Malaria vpc05146   Amoebiasis vpc05161   Hepatitis B vpc05163   Human cytomegalovirus infection vpc05164   Influenza A vpc05167   Kaposi sarcoma-associated herpesvirus infection vpc05171   Coronavirus disease - COVID-19 vpc05200   Pathways in cancer vpc05202   Transcriptional misregulation in cancer vpc05219   Bladder cancer vpc05323   Rheumatoid arthritis vpc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:vpc00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     102533127 (CXCL8)    04072 Phospholipase D signaling pathway     102533127 (CXCL8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102533127 (CXCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     102533127 (CXCL8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     102533127 (CXCL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102533127 (CXCL8)    04621 NOD-like receptor signaling pathway     102533127 (CXCL8)    04622 RIG-I-like receptor signaling pathway     102533127 (CXCL8)    04657 IL-17 signaling pathway     102533127 (CXCL8)    04062 Chemokine signaling pathway     102533127 (CXCL8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102533127 (CXCL8)    05202 Transcriptional misregulation in cancer     102533127 (CXCL8)   09162 Cancer: specific types    05219 Bladder cancer     102533127 (CXCL8)   09172 Infectious disease: viral    05161 Hepatitis B     102533127 (CXCL8)    05171 Coronavirus disease - COVID-19     102533127 (CXCL8)    05164 Influenza A     102533127 (CXCL8)    05163 Human cytomegalovirus infection     102533127 (CXCL8)    05167 Kaposi sarcoma-associated herpesvirus infection     102533127 (CXCL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     102533127 (CXCL8)    05135 Yersinia infection     102533127 (CXCL8)    05133 Pertussis     102533127 (CXCL8)    05134 Legionellosis     102533127 (CXCL8)   09174 Infectious disease: parasitic    05146 Amoebiasis     102533127 (CXCL8)    05144 Malaria     102533127 (CXCL8)    05142 Chagas disease     102533127 (CXCL8)   09163 Immune disease    05323 Rheumatoid arthritis     102533127 (CXCL8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102533127 (CXCL8)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102533127 (CXCL8)    04932 Non-alcoholic fatty liver disease     102533127 (CXCL8)    04933 AGE-RAGE signaling pathway in diabetic complications     102533127 (CXCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vpc04052]     102533127 (CXCL8)    00536 Glycosaminoglycan binding proteins [BR:vpc00536]     102533127 (CXCL8) Cytokines and neuropeptides [BR:vpc04052]  Cytokines   Chemokines    102533127 (CXCL8) Glycosaminoglycan binding proteins [BR:vpc00536]  Heparan sulfate / Heparin   Chemokines    102533127 (CXCL8) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  102533127 NCBI-ProteinID:  XP_006212592 UniProt:  A0A6I9IKA1 LinkDB All DBs Position 2 AA seq 101 aa AA seqDB search MTSKLAVALLAAFLISAAVCEAAVLSRLSSELRCQCINTHSTPFHPKFIKELRVIESGPH CENTEIIVKLANGREVCLNPKEKWVQKVVEIFLKRAEKQNP NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgacttccaagctggctgttgctctcttggcagctttcttgatttctgcagctgtgtgt gaagctgcagttctgtcaagactgagttcagaacttcgatgccaatgcataaatacacac tccacacctttccaccccaaatttatcaaagaactaagagtgattgagagtggacctcac tgtgaaaatacagaaatcattgttaagcttgccaatggaagagaggtctgcctgaatccc aaggaaaagtgggtgcagaaggttgtggagatatttttgaagagagctgagaagcaaaat ccatga

DBGET integrated database retrieval system