Vicugna pacos (alpaca): 102534196 Help Entry 102534196         CDS       T08098                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism vpc  Vicugna pacos (alpaca) Pathway vpc04014   Ras signaling pathway vpc04015   Rap1 signaling pathway vpc04022   cGMP-PKG signaling pathway vpc04024   cAMP signaling pathway vpc04062   Chemokine signaling pathway vpc04071   Sphingolipid signaling pathway vpc04072   Phospholipase D signaling pathway vpc04081   Hormone signaling vpc04144   Endocytosis vpc04150   mTOR signaling pathway vpc04270   Vascular smooth muscle contraction vpc04310   Wnt signaling pathway vpc04350   TGF-beta signaling pathway vpc04360   Axon guidance vpc04510   Focal adhesion vpc04520   Adherens junction vpc04530   Tight junction vpc04611   Platelet activation vpc04621   NOD-like receptor signaling pathway vpc04625   C-type lectin receptor signaling pathway vpc04660   T cell receptor signaling pathway vpc04670   Leukocyte transendothelial migration vpc04722   Neurotrophin signaling pathway vpc04810   Regulation of actin cytoskeleton vpc04921   Oxytocin signaling pathway vpc04928   Parathyroid hormone synthesis, secretion and action vpc04972   Pancreatic secretion vpc05100   Bacterial invasion of epithelial cells vpc05132   Salmonella infection vpc05133   Pertussis vpc05135   Yersinia infection vpc05152   Tuberculosis vpc05163   Human cytomegalovirus infection vpc05200   Pathways in cancer vpc05203   Viral carcinogenesis vpc05205   Proteoglycans in cancer vpc05206   MicroRNAs in cancer vpc05210   Colorectal cancer vpc05417   Lipid and atherosclerosis vpc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:vpc00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102534196 (RHOA)    04015 Rap1 signaling pathway     102534196 (RHOA)    04310 Wnt signaling pathway     102534196 (RHOA)    04350 TGF-beta signaling pathway     102534196 (RHOA)    04072 Phospholipase D signaling pathway     102534196 (RHOA)    04071 Sphingolipid signaling pathway     102534196 (RHOA)    04024 cAMP signaling pathway     102534196 (RHOA)    04022 cGMP-PKG signaling pathway     102534196 (RHOA)    04150 mTOR signaling pathway     102534196 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     102534196 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102534196 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102534196 (RHOA)    04520 Adherens junction     102534196 (RHOA)    04530 Tight junction     102534196 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102534196 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102534196 (RHOA)    04621 NOD-like receptor signaling pathway     102534196 (RHOA)    04625 C-type lectin receptor signaling pathway     102534196 (RHOA)    04660 T cell receptor signaling pathway     102534196 (RHOA)    04670 Leukocyte transendothelial migration     102534196 (RHOA)    04062 Chemokine signaling pathway     102534196 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     102534196 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     102534196 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     102534196 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     102534196 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     102534196 (RHOA)   09158 Development and regeneration    04360 Axon guidance     102534196 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102534196 (RHOA)    05206 MicroRNAs in cancer     102534196 (RHOA)    05205 Proteoglycans in cancer     102534196 (RHOA)    05203 Viral carcinogenesis     102534196 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     102534196 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     102534196 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     102534196 (RHOA)    05135 Yersinia infection     102534196 (RHOA)    05133 Pertussis     102534196 (RHOA)    05152 Tuberculosis     102534196 (RHOA)    05100 Bacterial invasion of epithelial cells     102534196 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102534196 (RHOA)    05418 Fluid shear stress and atherosclerosis     102534196 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vpc04131]     102534196 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vpc04147]     102534196 (RHOA)    04031 GTP-binding proteins [BR:vpc04031]     102534196 (RHOA) Membrane trafficking [BR:vpc04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     102534196 (RHOA) Exosome [BR:vpc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102534196 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    102534196 (RHOA)   Exosomal proteins of colorectal cancer cells    102534196 (RHOA)   Exosomal proteins of bladder cancer cells    102534196 (RHOA) GTP-binding proteins [BR:vpc04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     102534196 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  102534196 NCBI-ProteinID:  XP_006196359 UniProt:  A0A6I9HX56 LinkDB All DBs Position 17 AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgctatccggaagaaattggtgatagttggtgatggagcctgtggcaagacttgc ttgctcattgtctttagcaaggaccagttcccggaggtgtatgtacctacggtatttgag aactatgtggcagatattgaagtggatggaaagcaggtagagttggctttgtgggacaca gctgggcaggaagattatgatcgcttgaggcccctctcctacccggataccgatgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact ccggaagtcaagcatttctgtccgaacgtgcccatcatcctggttgggaacaagaaggat cttcgaaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccagtaaag ccagaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgctca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacaagagctgctctgcaa gccagacgtggaaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system