Vicugna pacos (alpaca): 102534373 Help Entry 102534373         CDS       T08098                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism vpc  Vicugna pacos (alpaca) Pathway vpc04015   Rap1 signaling pathway vpc04810   Regulation of actin cytoskeleton vpc05014   Amyotrophic lateral sclerosis vpc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:vpc00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102534373 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102534373 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102534373 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102534373 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vpc04131]     102534373 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:vpc04812]     102534373 (PFN4)    04147 Exosome [BR:vpc04147]     102534373 (PFN4) Membrane trafficking [BR:vpc04131]  Others   Actin-binding proteins    Others     102534373 (PFN4) Cytoskeleton proteins [BR:vpc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102534373 (PFN4) Exosome [BR:vpc04147]  Exosomal proteins   Proteins found in most exosomes    102534373 (PFN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  102534373 NCBI-ProteinID:  XP_006197218 UniProt:  A0A6I9HVG3 LinkDB All DBs Position 15 AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQERSLCVASPGFSVMPRDVRTLVNGFAKNPLIAR REGLYFKEKDYKCIRADEYSLYAKNENTGVVVVKTQLYLLVATYTEGMYPSVCVEATEKL GDYLRRKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatctgcagaacttactgttagataccctactgggaacgaagcatgtggacagt gcagccctcatcaaactccaggagcggagcctttgtgtagcatcaccaggattcagtgta atgccccgtgatgtccgaacacttgttaatggattcgccaagaaccctttgatagccaga agagaaggattgtatttcaaggagaaggactacaaatgtatccgggcagatgagtattct ctttatgctaagaatgaaaatactggtgtcgttgttgtgaagacccaactgtatcttctg gtggcaacttacactgagggcatgtatcctagtgtctgtgtggaagccacagagaagctg ggagactatctaagaagaaaaggaaattaa

DBGET integrated database retrieval system