KEGG   Vicugna pacos (alpaca): 102534785
Entry
102534785         CDS       T08098                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
vpc  Vicugna pacos (alpaca)
Pathway
vpc01521  EGFR tyrosine kinase inhibitor resistance
vpc01522  Endocrine resistance
vpc04010  MAPK signaling pathway
vpc04012  ErbB signaling pathway
vpc04014  Ras signaling pathway
vpc04015  Rap1 signaling pathway
vpc04062  Chemokine signaling pathway
vpc04068  FoxO signaling pathway
vpc04071  Sphingolipid signaling pathway
vpc04072  Phospholipase D signaling pathway
vpc04137  Mitophagy - animal
vpc04140  Autophagy - animal
vpc04150  mTOR signaling pathway
vpc04151  PI3K-Akt signaling pathway
vpc04210  Apoptosis
vpc04211  Longevity regulating pathway
vpc04213  Longevity regulating pathway - multiple species
vpc04218  Cellular senescence
vpc04360  Axon guidance
vpc04370  VEGF signaling pathway
vpc04371  Apelin signaling pathway
vpc04540  Gap junction
vpc04550  Signaling pathways regulating pluripotency of stem cells
vpc04625  C-type lectin receptor signaling pathway
vpc04650  Natural killer cell mediated cytotoxicity
vpc04660  T cell receptor signaling pathway
vpc04662  B cell receptor signaling pathway
vpc04664  Fc epsilon RI signaling pathway
vpc04714  Thermogenesis
vpc04720  Long-term potentiation
vpc04722  Neurotrophin signaling pathway
vpc04725  Cholinergic synapse
vpc04726  Serotonergic synapse
vpc04730  Long-term depression
vpc04810  Regulation of actin cytoskeleton
vpc04910  Insulin signaling pathway
vpc04912  GnRH signaling pathway
vpc04915  Estrogen signaling pathway
vpc04916  Melanogenesis
vpc04917  Prolactin signaling pathway
vpc04919  Thyroid hormone signaling pathway
vpc04921  Oxytocin signaling pathway
vpc04926  Relaxin signaling pathway
vpc04929  GnRH secretion
vpc04933  AGE-RAGE signaling pathway in diabetic complications
vpc04935  Growth hormone synthesis, secretion and action
vpc05010  Alzheimer disease
vpc05022  Pathways of neurodegeneration - multiple diseases
vpc05034  Alcoholism
vpc05160  Hepatitis C
vpc05161  Hepatitis B
vpc05163  Human cytomegalovirus infection
vpc05165  Human papillomavirus infection
vpc05166  Human T-cell leukemia virus 1 infection
vpc05167  Kaposi sarcoma-associated herpesvirus infection
vpc05170  Human immunodeficiency virus 1 infection
vpc05200  Pathways in cancer
vpc05203  Viral carcinogenesis
vpc05205  Proteoglycans in cancer
vpc05206  MicroRNAs in cancer
vpc05207  Chemical carcinogenesis - receptor activation
vpc05208  Chemical carcinogenesis - reactive oxygen species
vpc05210  Colorectal cancer
vpc05211  Renal cell carcinoma
vpc05213  Endometrial cancer
vpc05214  Glioma
vpc05215  Prostate cancer
vpc05216  Thyroid cancer
vpc05218  Melanoma
vpc05219  Bladder cancer
vpc05220  Chronic myeloid leukemia
vpc05221  Acute myeloid leukemia
vpc05223  Non-small cell lung cancer
vpc05224  Breast cancer
vpc05225  Hepatocellular carcinoma
vpc05226  Gastric cancer
vpc05230  Central carbon metabolism in cancer
vpc05231  Choline metabolism in cancer
vpc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
vpc05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vpc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102534785 (NRAS)
   04012 ErbB signaling pathway
    102534785 (NRAS)
   04014 Ras signaling pathway
    102534785 (NRAS)
   04015 Rap1 signaling pathway
    102534785 (NRAS)
   04370 VEGF signaling pathway
    102534785 (NRAS)
   04371 Apelin signaling pathway
    102534785 (NRAS)
   04068 FoxO signaling pathway
    102534785 (NRAS)
   04072 Phospholipase D signaling pathway
    102534785 (NRAS)
   04071 Sphingolipid signaling pathway
    102534785 (NRAS)
   04151 PI3K-Akt signaling pathway
    102534785 (NRAS)
   04150 mTOR signaling pathway
    102534785 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102534785 (NRAS)
   04137 Mitophagy - animal
    102534785 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    102534785 (NRAS)
   04218 Cellular senescence
    102534785 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102534785 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    102534785 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102534785 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102534785 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    102534785 (NRAS)
   04660 T cell receptor signaling pathway
    102534785 (NRAS)
   04662 B cell receptor signaling pathway
    102534785 (NRAS)
   04664 Fc epsilon RI signaling pathway
    102534785 (NRAS)
   04062 Chemokine signaling pathway
    102534785 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102534785 (NRAS)
   04929 GnRH secretion
    102534785 (NRAS)
   04912 GnRH signaling pathway
    102534785 (NRAS)
   04915 Estrogen signaling pathway
    102534785 (NRAS)
   04917 Prolactin signaling pathway
    102534785 (NRAS)
   04921 Oxytocin signaling pathway
    102534785 (NRAS)
   04926 Relaxin signaling pathway
    102534785 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    102534785 (NRAS)
   04919 Thyroid hormone signaling pathway
    102534785 (NRAS)
   04916 Melanogenesis
    102534785 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    102534785 (NRAS)
   04726 Serotonergic synapse
    102534785 (NRAS)
   04720 Long-term potentiation
    102534785 (NRAS)
   04730 Long-term depression
    102534785 (NRAS)
   04722 Neurotrophin signaling pathway
    102534785 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    102534785 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    102534785 (NRAS)
   04213 Longevity regulating pathway - multiple species
    102534785 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    102534785 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102534785 (NRAS)
   05206 MicroRNAs in cancer
    102534785 (NRAS)
   05205 Proteoglycans in cancer
    102534785 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    102534785 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    102534785 (NRAS)
   05203 Viral carcinogenesis
    102534785 (NRAS)
   05230 Central carbon metabolism in cancer
    102534785 (NRAS)
   05231 Choline metabolism in cancer
    102534785 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102534785 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102534785 (NRAS)
   05225 Hepatocellular carcinoma
    102534785 (NRAS)
   05226 Gastric cancer
    102534785 (NRAS)
   05214 Glioma
    102534785 (NRAS)
   05216 Thyroid cancer
    102534785 (NRAS)
   05221 Acute myeloid leukemia
    102534785 (NRAS)
   05220 Chronic myeloid leukemia
    102534785 (NRAS)
   05218 Melanoma
    102534785 (NRAS)
   05211 Renal cell carcinoma
    102534785 (NRAS)
   05219 Bladder cancer
    102534785 (NRAS)
   05215 Prostate cancer
    102534785 (NRAS)
   05213 Endometrial cancer
    102534785 (NRAS)
   05224 Breast cancer
    102534785 (NRAS)
   05223 Non-small cell lung cancer
    102534785 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102534785 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    102534785 (NRAS)
   05161 Hepatitis B
    102534785 (NRAS)
   05160 Hepatitis C
    102534785 (NRAS)
   05163 Human cytomegalovirus infection
    102534785 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102534785 (NRAS)
   05165 Human papillomavirus infection
    102534785 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102534785 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    102534785 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    102534785 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102534785 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102534785 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102534785 (NRAS)
   01522 Endocrine resistance
    102534785 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vpc04131]
    102534785 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vpc04147]
    102534785 (NRAS)
   04031 GTP-binding proteins [BR:vpc04031]
    102534785 (NRAS)
Membrane trafficking [BR:vpc04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    102534785 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    102534785 (NRAS)
Exosome [BR:vpc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102534785 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   102534785 (NRAS)
  Exosomal proteins of breast cancer cells
   102534785 (NRAS)
  Exosomal proteins of colorectal cancer cells
   102534785 (NRAS)
GTP-binding proteins [BR:vpc04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    102534785 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 102534785
NCBI-ProteinID: XP_006213751
UniProt: A0A6I9IJK5
LinkDB
Position
9
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
cgaaaacaagtggttatagatggtgaaacctgtctgttggacatactggatacagctgga
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt
gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt
aaacgagtaaaagactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattcca
ttcatcgaaacctcagccaagaccagacagggtgttgaagatgccttttatacactggta
agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatggaactcaaggt
tgtatggggttgccgtgtgtggtgatgtaa

DBGET integrated database retrieval system