Vicugna pacos (alpaca): 102535531 Help Entry 102535531         CDS       T08098                                  Name (RefSeq) C-C motif chemokine 3   KO K05408   C-C motif chemokine 3 Organism vpc  Vicugna pacos (alpaca) Pathway vpc04060   Cytokine-cytokine receptor interaction vpc04061   Viral protein interaction with cytokine and cytokine receptor vpc04062   Chemokine signaling pathway vpc04620   Toll-like receptor signaling pathway vpc05142   Chagas disease vpc05163   Human cytomegalovirus infection vpc05323   Rheumatoid arthritis vpc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:vpc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102535531    04061 Viral protein interaction with cytokine and cytokine receptor     102535531  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102535531    04062 Chemokine signaling pathway     102535531  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     102535531   09174 Infectious disease: parasitic    05142 Chagas disease     102535531   09163 Immune disease    05323 Rheumatoid arthritis     102535531   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102535531  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vpc04052]     102535531    00536 Glycosaminoglycan binding proteins [BR:vpc00536]     102535531 Cytokines and neuropeptides [BR:vpc04052]  Cytokines   Chemokines    102535531 Glycosaminoglycan binding proteins [BR:vpc00536]  Heparan sulfate / Heparin   Chemokines    102535531 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  102535531 NCBI-ProteinID:  XP_006213396 UniProt:  A0A6I9ILH6 LinkDB All DBs Position 16 AA seq 92 aa AA seqDB search MQVPTAALAVLVCAMALCSQVFSAPFGADTPTACCFSYGRQIPRKFIVDYFETSSQCSKP GVIFETKRSRQVCADPSEDWVQEYINDLELNA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcaggtgcccacggctgccctcgccgtcctcgtctgtgccatggccctctgcagccag gtcttctctgcgccatttggtgctgacaccccaaccgcctgctgcttctcctacggccgg cagattcctcgaaaattcatagtcgactatttcgagaccagcagtcagtgctccaagcct ggtgtcatcttcgaaaccaaaaggagccggcaggtctgtgccgaccccagtgaggactgg gtccaggaatacatcaacgacctggagctgaatgcctga

DBGET integrated database retrieval system