Vicugna pacos (alpaca): 102535696 Help Entry 102535696         CDS       T08098                                  Symbol TUBB6 Name (RefSeq) tubulin beta-6 chain   KO K07375   tubulin beta Organism vpc  Vicugna pacos (alpaca) Pathway vpc04145   Phagosome vpc04517   IgSF CAM signaling vpc04540   Gap junction vpc04814   Motor proteins vpc05010   Alzheimer disease vpc05012   Parkinson disease vpc05014   Amyotrophic lateral sclerosis vpc05016   Huntington disease vpc05020   Prion disease vpc05022   Pathways of neurodegeneration - multiple diseases vpc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:vpc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     102535696 (TUBB6)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102535696 (TUBB6)   09144 Cellular community - eukaryotes    04540 Gap junction     102535696 (TUBB6)   09142 Cell motility    04814 Motor proteins     102535696 (TUBB6)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102535696 (TUBB6)   09164 Neurodegenerative disease    05010 Alzheimer disease     102535696 (TUBB6)    05012 Parkinson disease     102535696 (TUBB6)    05014 Amyotrophic lateral sclerosis     102535696 (TUBB6)    05016 Huntington disease     102535696 (TUBB6)    05020 Prion disease     102535696 (TUBB6)    05022 Pathways of neurodegeneration - multiple diseases     102535696 (TUBB6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vpc03036]     102535696 (TUBB6)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:vpc04812]     102535696 (TUBB6)    04147 Exosome [BR:vpc04147]     102535696 (TUBB6) Chromosome and associated proteins [BR:vpc03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Other tubulins      102535696 (TUBB6) Cytoskeleton proteins [BR:vpc04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulins     102535696 (TUBB6) Exosome [BR:vpc04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102535696 (TUBB6)   Exosomal proteins of colorectal cancer cells    102535696 (TUBB6)   Exosomal proteins of bladder cancer cells    102535696 (TUBB6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tubulin Tubulin_3 Tubulin_2 Motif Other DBs NCBI-GeneID:  102535696 NCBI-ProteinID:  XP_031546014 LinkDB All DBs Position 24 AA seq 232 aa AA seqDB search WEVISDEHGIDPAGGYVGDSALQLERINVYYNESSSQKYVPRAALVDLEPGTMDSVRSGP FGQLFRPDNFIFGQTGAGNNWAKGHYTEGAELVDAVLDVVRKECEHCDCLQGFQLTHSLG GGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETY CIDNEGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEGEEAFEDEDEEVDE NT seq 699 nt NT seq  +upstreamnt  +downstreamnt tgggaagtgatcagcgacgaacacggcatcgacccggccggaggctacgtgggcgactcg gcgctccagctggagaggatcaacgtctactacaatgagtcatcgtctcagaaatacgtg cccagggccgccctggtggacttggagccgggcaccatggacagcgtgcggtccgggcct ttcgggcagctcttccggcctgacaacttcatttttggacagaccggtgccgggaacaac tgggccaagggccactacacggagggcgccgagctggtggacgccgtcctggacgtggtg cggaaggagtgcgagcactgtgactgcctgcagggcttccagctgacccactcgctgggg ggcggcacggggtcggggatggggaccctcctcatcagcaagatccgggaggagtacccc gaccgcatcatgaacaccttcagcgtgatgccctcgcccaaggtgtcggacaccgtggtc gagccctacaacgccaccctctccgtgcaccagctggtggagaacacggacgagacctac tgcatcgacaatgagggagagggcatggacgagatggagttcaccgaggccgagagcaac atgaacgacctggtgtccgagtaccagcagtaccaggatgccacggctgacgagggcgag gaggcctttgaggacgaggacgaggaggtcgacgagtag

DBGET integrated database retrieval system