Vicugna pacos (alpaca): 102536395 Help Entry 102536395         CDS       T08098                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism vpc  Vicugna pacos (alpaca) Pathway vpc04382   Cornified envelope formation vpc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:vpc00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     102536395 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102536395 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vpc04147]     102536395 (S100A10) Exosome [BR:vpc04147]  Exosomal proteins   Exosomal proteins of microglial cells    102536395 (S100A10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 TMP_3 Motif Other DBs NCBI-GeneID:  102536395 NCBI-ProteinID:  XP_006217073 UniProt:  A0A6I9INZ6 LinkDB All DBs Position 21 AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatggaacacgccatggaaaccatgatgttcacgtttcacaaatttgct ggggataaaggctacttaacaaaggaggacctgcgagtactcatggaaaaggagttccct ggatttttggaaaatcaaaaagaccccctggccgtggacaagataatgaaggacctggac cagtgccgggacggcaaagtgggcttccagagcttcttctcgctgatcgccgggctcacc attgcgtgcaatgactactttgtggtgcacatgaagcagaagggaaagaagtag

DBGET integrated database retrieval system