Vicugna pacos (alpaca): 102538668 Help Entry 102538668         CDS       T08098                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism vpc  Vicugna pacos (alpaca) Pathway vpc04014   Ras signaling pathway vpc04137   Mitophagy - animal vpc04144   Endocytosis vpc04145   Phagocytosis vpc04148   Efferocytosis vpc04962   Vasopressin-regulated water reabsorption vpc05014   Amyotrophic lateral sclerosis vpc05022   Pathways of neurodegeneration - multiple diseases vpc05132   Salmonella infection vpc05146   Amoebiasis vpc05152   Tuberculosis Brite KEGG Orthology (KO) [BR:vpc00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102538668 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102538668 (RAB5A)    04145 Phagocytosis     102538668 (RAB5A)    04137 Mitophagy - animal     102538668 (RAB5A)    04148 Efferocytosis     102538668 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     102538668 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102538668 (RAB5A)    05152 Tuberculosis     102538668 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     102538668 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102538668 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     102538668 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vpc04131]     102538668 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vpc04147]     102538668 (RAB5A)    04031 GTP-binding proteins [BR:vpc04031]     102538668 (RAB5A) Membrane trafficking [BR:vpc04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     102538668 (RAB5A)  Endosome - Lysosome transport     102538668 (RAB5A) Exosome [BR:vpc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102538668 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    102538668 (RAB5A)   Exosomal proteins of colorectal cancer cells    102538668 (RAB5A)   Exosomal proteins of bladder cancer cells    102538668 (RAB5A) GTP-binding proteins [BR:vpc04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     102538668 (RAB5A) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  102538668 NCBI-ProteinID:  XP_006205358 UniProt:  A0A6I9I7B6 LinkDB All DBs Position 1 AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQAYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatttgccag ttcaaactagtacttctgggagagtctgctgttggcaaatcaagcctagtgcttcgtttt gtgaagggccaatttcatgaatttcaagagagtaccatcggggctgcttttctaacccaa accgtgtgtcttgatgacacaacggtaaagtttgagatatgggatacagctggtcaagaa cggtaccatagcctagcaccgatgtactacagaggagcacaagcagccatagttgtgtac gatatcacaaatgaggagtcttttgccagagctaaaaactgggttaaagaacttcagagg caagccagtcctaacattgtaatagctttatcaggaaataaggctgacctcgcaaataaa agagctgtggacttccaggaagcacaggcctatgcagatgacaacagtttattatttatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaag ttgccaaagaatgaaccacagaatccaggagcaaattctgccagaggaagaggagtagac cttactgaacccacacagccaacaaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system