Vicugna pacos (alpaca): 102538751 Help Entry 102538751         CDS       T08098                                  Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism vpc  Vicugna pacos (alpaca) Pathway vpc04010   MAPK signaling pathway vpc04020   Calcium signaling pathway vpc04022   cGMP-PKG signaling pathway vpc04114   Oocyte meiosis vpc04218   Cellular senescence vpc04310   Wnt signaling pathway vpc04360   Axon guidance vpc04370   VEGF signaling pathway vpc04380   Osteoclast differentiation vpc04625   C-type lectin receptor signaling pathway vpc04650   Natural killer cell mediated cytotoxicity vpc04658   Th1 and Th2 cell differentiation vpc04659   Th17 cell differentiation vpc04660   T cell receptor signaling pathway vpc04662   B cell receptor signaling pathway vpc04720   Long-term potentiation vpc04724   Glutamatergic synapse vpc04921   Oxytocin signaling pathway vpc04922   Glucagon signaling pathway vpc04924   Renin secretion vpc05010   Alzheimer disease vpc05014   Amyotrophic lateral sclerosis vpc05020   Prion disease vpc05022   Pathways of neurodegeneration - multiple diseases vpc05031   Amphetamine addiction vpc05152   Tuberculosis vpc05163   Human cytomegalovirus infection vpc05166   Human T-cell leukemia virus 1 infection vpc05167   Kaposi sarcoma-associated herpesvirus infection vpc05170   Human immunodeficiency virus 1 infection vpc05235   PD-L1 expression and PD-1 checkpoint pathway in cancer vpc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:vpc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102538751    04310 Wnt signaling pathway     102538751    04370 VEGF signaling pathway     102538751    04020 Calcium signaling pathway     102538751    04022 cGMP-PKG signaling pathway     102538751  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102538751    04218 Cellular senescence     102538751  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102538751    04650 Natural killer cell mediated cytotoxicity     102538751    04660 T cell receptor signaling pathway     102538751    04658 Th1 and Th2 cell differentiation     102538751    04659 Th17 cell differentiation     102538751    04662 B cell receptor signaling pathway     102538751   09152 Endocrine system    04922 Glucagon signaling pathway     102538751    04921 Oxytocin signaling pathway     102538751    04924 Renin secretion     102538751   09156 Nervous system    04724 Glutamatergic synapse     102538751    04720 Long-term potentiation     102538751   09158 Development and regeneration    04360 Axon guidance     102538751    04380 Osteoclast differentiation     102538751  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102538751   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102538751    05170 Human immunodeficiency virus 1 infection     102538751    05163 Human cytomegalovirus infection     102538751    05167 Kaposi sarcoma-associated herpesvirus infection     102538751   09171 Infectious disease: bacterial    05152 Tuberculosis     102538751   09164 Neurodegenerative disease    05010 Alzheimer disease     102538751    05014 Amyotrophic lateral sclerosis     102538751    05020 Prion disease     102538751    05022 Pathways of neurodegeneration - multiple diseases     102538751   09165 Substance dependence    05031 Amphetamine addiction     102538751   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102538751  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:vpc01009]     102538751 Protein phosphatases and associated proteins [BR:vpc01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102538751 SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF_SSP120 EF-hand_FSTL1 EH EF-hand_9 SPARC_Ca_bdg RSA-1_C flgK_1st_1 DUF3944 Motif Other DBs NCBI-GeneID:  102538751 NCBI-ProteinID:  XP_006220122 UniProt:  A0A6I9IVF5 LinkDB All DBs Position Unknown AA seq 127 aa AA seqDB search MSLPELQENPLVQRVIDIFDTDGNGEVDFKEFILGTSQFSVRGDEEQKLRFAFNIYDMDK DGYISNGELFQVLKMMVGDHLEDWQLQQLVDKTIITMDKDGDGKISFQEFSAVVGGLEVH KKLVAIF NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgtccctgcccgagctacaggagaacccgttggtgcagcgagtgatcgacatcttcgac actgacggcaacggagaggtggacttcaaggaattcatcctggggacctcccagttcagt gtcaggggagacgaggagcagaagctgaggtttgctttcaacatctacgacatggacaaa gacggctacatttccaacggggagctcttccaggtgctgaagatgatggtgggggaccac ctggaagactggcagttgcagcagctcgtggacaaaaccatcatcaccatggacaaggac ggcgacggcaaaatatccttccaggaattcagtgctgtggtcggaggcctggaagtccac aagaagttggtggcaattttttga

DBGET integrated database retrieval system