Vicugna pacos (alpaca): 102539524 Help Entry 102539524         CDS       T08098                                  Symbol RAB10 Name (RefSeq) ras-related protein Rab-10   KO K07903   Ras-related protein Rab-10 Organism vpc  Vicugna pacos (alpaca) Pathway vpc04144   Endocytosis vpc04152   AMPK signaling pathway Brite KEGG Orthology (KO) [BR:vpc00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     102539524 (RAB10)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102539524 (RAB10)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vpc04131]     102539524 (RAB10)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vpc04147]     102539524 (RAB10)    04031 GTP-binding proteins [BR:vpc04031]     102539524 (RAB10) Membrane trafficking [BR:vpc04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     102539524 (RAB10)  Protein recycling   Rab GTPases and associated proteins     102539524 (RAB10) Exosome [BR:vpc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102539524 (RAB10)   Exosomal proteins of other body fluids (saliva and urine)    102539524 (RAB10)   Exosomal proteins of colorectal cancer cells    102539524 (RAB10)   Exosomal proteins of bladder cancer cells    102539524 (RAB10) GTP-binding proteins [BR:vpc04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     102539524 (RAB10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 SRPRB AAA_7 DUF3963 Motif Other DBs NCBI-GeneID:  102539524 NCBI-ProteinID:  XP_006197239 UniProt:  A0A6I9HYH4 LinkDB All DBs Position 15 AA seq 200 aa AA seqDB search MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKL QIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLL GNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPN SENVDISSGGGVTGWKSKCC NT seq 603 nt NT seq  +upstreamnt  +downstreamnt atggcgaagaagacgtacgacctgcttttcaagctgctcctgatcggggactcgggagtg gggaagacctgcgtcctttttcgtttttcggatgatgccttcaataccacctttatttcc accataggaatagactttaagatcaaaacagttgaattacaaggaaagaagatcaagcta cagatatgggatacggcaggccaggagcgatttcacaccatcacaacctcctactacaga ggagcaatgggtatcatgctagtatatgacatcaccaatggtaaaagttttgaaaacatc agcaaatggcttagaaacatagatgagcatgccaacgaagatgtggaaagaatgttacta ggaaacaaatgtgatatggacgataaaagagttgtccctaaaggaaaaggagaacagatt gcaagggagcatggtattagattttttgagactagtgcaaaagcaaatataaacatcgaa aaggcgttcctcacgttagctgaagatattcttcgaaagacccctgtaaaagagcccaac agtgaaaacgtagatatcagcagtggaggaggcgtgacaggctggaagagcaaatgttgc tga

DBGET integrated database retrieval system