Vicugna pacos (alpaca): 102541613 Help Entry 102541613         CDS       T08098                                  Name (RefSeq) glutathione S-transferase P-like   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism vpc  Vicugna pacos (alpaca) Pathway vpc00480   Glutathione metabolism vpc00980   Metabolism of xenobiotics by cytochrome P450 vpc00982   Drug metabolism - cytochrome P450 vpc00983   Drug metabolism - other enzymes vpc01100   Metabolic pathways vpc01524   Platinum drug resistance vpc05200   Pathways in cancer vpc05204   Chemical carcinogenesis - DNA adducts vpc05215   Prostate cancer vpc05225   Hepatocellular carcinoma vpc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:vpc00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102541613   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102541613    00982 Drug metabolism - cytochrome P450     102541613    00983 Drug metabolism - other enzymes     102541613  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102541613    05204 Chemical carcinogenesis - DNA adducts     102541613   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102541613    05215 Prostate cancer     102541613   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102541613   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102541613  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:vpc02000]     102541613 Enzymes [BR:vpc01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102541613 Transporters [BR:vpc02000]  Other transporters   Pores ion channels [TC:1]    102541613 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_7 GST_C_2 GST_N_3 Motif Other DBs NCBI-GeneID:  102541613 NCBI-ProteinID:  XP_015094111 UniProt:  A0A6J0AIR5 LinkDB All DBs Position 23 AA seq 208 aa AA seqDB search MPPYTIVYFPVRGRCEAMHMLLADQDQSWKEEVETMETWPALKPSCLYGQLPKFQDGDLT LYQSNAILRHLGRSLGLYGKDQQEAALLDVVNDGVEDLRCKYATLIYTNYEAGKEGYVKA LPEHLKPFETLLSQNQGGQAFIVGNQISFADYNLLDLLLNHQVLAPGCLDSFPLLSAYVA RLSARPKLKAFLASPEHVKRPINGNGKQ NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgccgccctacaccattgtctacttccctgttcgagggcgctgcgaggccatgcacatg ctgctggctgaccaggaccagagctggaaggaggaggtggagaccatggagacctggcct gcactcaaaccctcctgtctgtacgggcagctccccaagttccaggatggagatctcacc ctgtaccagtccaatgccattctgcgtcacctgggccgctcacttggactgtatgggaag gaccagcaggaggcagcccttttggacgtggtgaatgatggcgtggaggacctccgttgc aaatatgccaccctcatctacaccaactacgaggcaggcaaggagggctatgtgaaggca ctgccggagcatctgaagccttttgagaccctgctgtcccagaaccagggaggccaggcc ttcatcgtgggcaaccagatctccttcgcagactacaacctgctggacttgctgctgaat caccaggtcctggcccctggctgcctggactccttccccctgctctcagcctacgtggct cgcctcagtgcccggcccaagctcaaggccttcttggcctcccctgagcacgtgaagcgc cctatcaatggcaacgggaagcagtga

DBGET integrated database retrieval system