Vicugna pacos (alpaca): 102542241 Help Entry 102542241         CDS       T08098                                  Symbol CALML5 Name (RefSeq) calmodulin-like protein 5   KO K02183   calmodulin Organism vpc  Vicugna pacos (alpaca) Pathway vpc04014   Ras signaling pathway vpc04015   Rap1 signaling pathway vpc04020   Calcium signaling pathway vpc04022   cGMP-PKG signaling pathway vpc04024   cAMP signaling pathway vpc04070   Phosphatidylinositol signaling system vpc04114   Oocyte meiosis vpc04218   Cellular senescence vpc04261   Adrenergic signaling in cardiomyocytes vpc04270   Vascular smooth muscle contraction vpc04371   Apelin signaling pathway vpc04625   C-type lectin receptor signaling pathway vpc04713   Circadian entrainment vpc04720   Long-term potentiation vpc04722   Neurotrophin signaling pathway vpc04728   Dopaminergic synapse vpc04740   Olfactory transduction vpc04744   Phototransduction vpc04750   Inflammatory mediator regulation of TRP channels vpc04910   Insulin signaling pathway vpc04912   GnRH signaling pathway vpc04915   Estrogen signaling pathway vpc04916   Melanogenesis vpc04921   Oxytocin signaling pathway vpc04922   Glucagon signaling pathway vpc04924   Renin secretion vpc04925   Aldosterone synthesis and secretion vpc04970   Salivary secretion vpc04971   Gastric acid secretion vpc05010   Alzheimer disease vpc05012   Parkinson disease vpc05022   Pathways of neurodegeneration - multiple diseases vpc05031   Amphetamine addiction vpc05034   Alcoholism vpc05133   Pertussis vpc05152   Tuberculosis vpc05163   Human cytomegalovirus infection vpc05167   Kaposi sarcoma-associated herpesvirus infection vpc05170   Human immunodeficiency virus 1 infection vpc05200   Pathways in cancer vpc05214   Glioma vpc05417   Lipid and atherosclerosis vpc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:vpc00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102542241 (CALML5)    04015 Rap1 signaling pathway     102542241 (CALML5)    04371 Apelin signaling pathway     102542241 (CALML5)    04020 Calcium signaling pathway     102542241 (CALML5)    04070 Phosphatidylinositol signaling system     102542241 (CALML5)    04024 cAMP signaling pathway     102542241 (CALML5)    04022 cGMP-PKG signaling pathway     102542241 (CALML5)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102542241 (CALML5)    04218 Cellular senescence     102542241 (CALML5)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102542241 (CALML5)   09152 Endocrine system    04910 Insulin signaling pathway     102542241 (CALML5)    04922 Glucagon signaling pathway     102542241 (CALML5)    04912 GnRH signaling pathway     102542241 (CALML5)    04915 Estrogen signaling pathway     102542241 (CALML5)    04921 Oxytocin signaling pathway     102542241 (CALML5)    04916 Melanogenesis     102542241 (CALML5)    04924 Renin secretion     102542241 (CALML5)    04925 Aldosterone synthesis and secretion     102542241 (CALML5)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102542241 (CALML5)    04270 Vascular smooth muscle contraction     102542241 (CALML5)   09154 Digestive system    04970 Salivary secretion     102542241 (CALML5)    04971 Gastric acid secretion     102542241 (CALML5)   09156 Nervous system    04728 Dopaminergic synapse     102542241 (CALML5)    04720 Long-term potentiation     102542241 (CALML5)    04722 Neurotrophin signaling pathway     102542241 (CALML5)   09157 Sensory system    04744 Phototransduction     102542241 (CALML5)    04740 Olfactory transduction     102542241 (CALML5)    04750 Inflammatory mediator regulation of TRP channels     102542241 (CALML5)   09159 Environmental adaptation    04713 Circadian entrainment     102542241 (CALML5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102542241 (CALML5)   09162 Cancer: specific types    05214 Glioma     102542241 (CALML5)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102542241 (CALML5)    05163 Human cytomegalovirus infection     102542241 (CALML5)    05167 Kaposi sarcoma-associated herpesvirus infection     102542241 (CALML5)   09171 Infectious disease: bacterial    05133 Pertussis     102542241 (CALML5)    05152 Tuberculosis     102542241 (CALML5)   09164 Neurodegenerative disease    05010 Alzheimer disease     102542241 (CALML5)    05012 Parkinson disease     102542241 (CALML5)    05022 Pathways of neurodegeneration - multiple diseases     102542241 (CALML5)   09165 Substance dependence    05031 Amphetamine addiction     102542241 (CALML5)    05034 Alcoholism     102542241 (CALML5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102542241 (CALML5)    05418 Fluid shear stress and atherosclerosis     102542241 (CALML5)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:vpc01009]     102542241 (CALML5)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vpc04131]     102542241 (CALML5)    03036 Chromosome and associated proteins [BR:vpc03036]     102542241 (CALML5)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vpc04147]     102542241 (CALML5) Protein phosphatases and associated proteins [BR:vpc01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102542241 (CALML5) Membrane trafficking [BR:vpc04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     102542241 (CALML5) Chromosome and associated proteins [BR:vpc03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      102542241 (CALML5) Exosome [BR:vpc04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102542241 (CALML5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 AIF-1 SPARC_Ca_bdg Dockerin_1 EH DUF5580_M FCaBP_EF-hand SurA_N_3 EF-hand_11 SurA_N_2 EF_EFCAB10_C Motif Other DBs NCBI-GeneID:  102542241 NCBI-ProteinID:  XP_015099539 UniProt:  A0A6J0ARZ7 LinkDB All DBs Position 35 AA seq 148 aa AA seqDB search MAEQLSEEQVAEFKMAFDSVDKNRDGVVNMEELGAVMRALDQAPSEAMLKEFISQMDTDG DSAINFQEFLVAMAKMKALGGKGHLREAFRAFDLDGNGRISVDELKQATAKLGVTLSLEE LDVMIREADVDQDGQVDYEEFLHILAQK NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggctgagcagctgtccgaggagcaggtggccgagttcaagatggcctttgacagtgtt gacaagaacagggacggtgtcgtcaacatggaggagctgggtgctgtgatgcgggccctg gaccaggccccgtcagaagccatgctgaaggagttcatctcccagatggacacggacggg gacagcgccatcaacttccaggagttcctggtggcgatggccaagatgaaggccttgggc ggcaagggccacctgcgggaggccttccgtgcctttgacctggatggcaacggccgcatc agcgtggacgagctcaagcaggccacggccaagcttggggtgacgctgtccctggaggag ctggacgtcatgatccgggaggccgacgtggaccaagacgggcaggtggattacgaggag ttcctgcacatcctggcccagaagtga

DBGET integrated database retrieval system