KEGG   Vicugna pacos (alpaca): 102543993
Entry
102543993         CDS       T08098                                 
Symbol
RAC1
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1 isoform X1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
vpc  Vicugna pacos (alpaca)
Pathway
vpc04010  MAPK signaling pathway
vpc04014  Ras signaling pathway
vpc04015  Rap1 signaling pathway
vpc04024  cAMP signaling pathway
vpc04062  Chemokine signaling pathway
vpc04071  Sphingolipid signaling pathway
vpc04145  Phagosome
vpc04148  Efferocytosis
vpc04151  PI3K-Akt signaling pathway
vpc04310  Wnt signaling pathway
vpc04360  Axon guidance
vpc04370  VEGF signaling pathway
vpc04380  Osteoclast differentiation
vpc04510  Focal adhesion
vpc04520  Adherens junction
vpc04530  Tight junction
vpc04613  Neutrophil extracellular trap formation
vpc04620  Toll-like receptor signaling pathway
vpc04650  Natural killer cell mediated cytotoxicity
vpc04662  B cell receptor signaling pathway
vpc04664  Fc epsilon RI signaling pathway
vpc04666  Fc gamma R-mediated phagocytosis
vpc04670  Leukocyte transendothelial migration
vpc04722  Neurotrophin signaling pathway
vpc04810  Regulation of actin cytoskeleton
vpc04932  Non-alcoholic fatty liver disease
vpc04933  AGE-RAGE signaling pathway in diabetic complications
vpc04972  Pancreatic secretion
vpc05014  Amyotrophic lateral sclerosis
vpc05020  Prion disease
vpc05022  Pathways of neurodegeneration - multiple diseases
vpc05100  Bacterial invasion of epithelial cells
vpc05132  Salmonella infection
vpc05135  Yersinia infection
vpc05163  Human cytomegalovirus infection
vpc05167  Kaposi sarcoma-associated herpesvirus infection
vpc05169  Epstein-Barr virus infection
vpc05170  Human immunodeficiency virus 1 infection
vpc05200  Pathways in cancer
vpc05203  Viral carcinogenesis
vpc05205  Proteoglycans in cancer
vpc05208  Chemical carcinogenesis - reactive oxygen species
vpc05210  Colorectal cancer
vpc05211  Renal cell carcinoma
vpc05212  Pancreatic cancer
vpc05231  Choline metabolism in cancer
vpc05415  Diabetic cardiomyopathy
vpc05416  Viral myocarditis
vpc05417  Lipid and atherosclerosis
vpc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vpc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102543993 (RAC1)
   04014 Ras signaling pathway
    102543993 (RAC1)
   04015 Rap1 signaling pathway
    102543993 (RAC1)
   04310 Wnt signaling pathway
    102543993 (RAC1)
   04370 VEGF signaling pathway
    102543993 (RAC1)
   04071 Sphingolipid signaling pathway
    102543993 (RAC1)
   04024 cAMP signaling pathway
    102543993 (RAC1)
   04151 PI3K-Akt signaling pathway
    102543993 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102543993 (RAC1)
   04148 Efferocytosis
    102543993 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102543993 (RAC1)
   04520 Adherens junction
    102543993 (RAC1)
   04530 Tight junction
    102543993 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102543993 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102543993 (RAC1)
   04620 Toll-like receptor signaling pathway
    102543993 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    102543993 (RAC1)
   04662 B cell receptor signaling pathway
    102543993 (RAC1)
   04664 Fc epsilon RI signaling pathway
    102543993 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    102543993 (RAC1)
   04670 Leukocyte transendothelial migration
    102543993 (RAC1)
   04062 Chemokine signaling pathway
    102543993 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    102543993 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102543993 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    102543993 (RAC1)
   04380 Osteoclast differentiation
    102543993 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102543993 (RAC1)
   05205 Proteoglycans in cancer
    102543993 (RAC1)
   05208 Chemical carcinogenesis - reactive oxygen species
    102543993 (RAC1)
   05203 Viral carcinogenesis
    102543993 (RAC1)
   05231 Choline metabolism in cancer
    102543993 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102543993 (RAC1)
   05212 Pancreatic cancer
    102543993 (RAC1)
   05211 Renal cell carcinoma
    102543993 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102543993 (RAC1)
   05163 Human cytomegalovirus infection
    102543993 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102543993 (RAC1)
   05169 Epstein-Barr virus infection
    102543993 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102543993 (RAC1)
   05135 Yersinia infection
    102543993 (RAC1)
   05100 Bacterial invasion of epithelial cells
    102543993 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102543993 (RAC1)
   05020 Prion disease
    102543993 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    102543993 (RAC1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102543993 (RAC1)
   05418 Fluid shear stress and atherosclerosis
    102543993 (RAC1)
   05415 Diabetic cardiomyopathy
    102543993 (RAC1)
   05416 Viral myocarditis
    102543993 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102543993 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102543993 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vpc04131]
    102543993 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vpc04147]
    102543993 (RAC1)
   04031 GTP-binding proteins [BR:vpc04031]
    102543993 (RAC1)
Membrane trafficking [BR:vpc04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    102543993 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    102543993 (RAC1)
  Macropinocytosis
   Ras GTPases
    102543993 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    102543993 (RAC1)
Exosome [BR:vpc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102543993 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   102543993 (RAC1)
  Exosomal proteins of colorectal cancer cells
   102543993 (RAC1)
  Exosomal proteins of bladder cancer cells
   102543993 (RAC1)
GTP-binding proteins [BR:vpc04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    102543993 (RAC1)
SSDB
Motif
Pfam: Ras Roc CagD
Other DBs
NCBI-GeneID: 102543993
NCBI-ProteinID: XP_031532676
UniProt: A0A6J3AJ50
LinkDB
Position
Unknown
AA seq 167 aa
MVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTVGEAYGKDIPSRGKDKPIADVFLICFSLV
SPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAM
AKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
NT seq 504 nt   +upstreamnt  +downstreamnt
atggtggatgggaagccagtgaacctgggcttatgggacacagctggacaagaagactat
gaccgattgcgtcccctctcctacccgcagacagttggagaagcgtatggtaaggatata
ccctccaggggcaaagacaagccgatcgctgatgtattcttaatttgcttttctcttgtg
agtcctgcatcatttgaaaatgttcgtgcaaagtggtatccagaggtgcgacaccattgt
cccaacacccctatcatcctggtggggacgaagcttgatcttagggatgataaggacacg
attgagaaactgaaggagaagaagctgaccccaatcacctacccacagggcttagccatg
gccaaggagatcggtgctgtgaagtacctggagtgctcagcgctcacgcagcgaggcctc
aagacagtgtttgatgaagccatccgagcggttctctgcccgccccccgtcaagaagagg
aagagaaaatgcctgctgttgtaa

DBGET integrated database retrieval system