Vicugna pacos (alpaca): 102543995 Help Entry 102543995         CDS       T08098                                  Symbol POLD4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism vpc  Vicugna pacos (alpaca) Pathway vpc03030   DNA replication vpc03410   Base excision repair vpc03420   Nucleotide excision repair vpc03430   Mismatch repair vpc03440   Homologous recombination Brite KEGG Orthology (KO) [BR:vpc00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     102543995 (POLD4)    03410 Base excision repair     102543995 (POLD4)    03420 Nucleotide excision repair     102543995 (POLD4)    03430 Mismatch repair     102543995 (POLD4)    03440 Homologous recombination     102543995 (POLD4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:vpc03032]     102543995 (POLD4)    03400 DNA repair and recombination proteins [BR:vpc03400]     102543995 (POLD4) DNA replication proteins [BR:vpc03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     102543995 (POLD4) DNA repair and recombination proteins [BR:vpc03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       102543995 (POLD4)    MMR (mismatch excision repair)     DNA polymerase delta complex      102543995 (POLD4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_pol_delta_4 DUF3303 Motif Other DBs NCBI-GeneID:  102543995 NCBI-ProteinID:  XP_006210760 UniProt:  A0A6I9IEF7 LinkDB All DBs Position 25 AA seq 107 aa AA seqDB search MGRKRLITDSYPVVKRRESPAGHSKRELAPELGEEPQPLSVDEAELELLRQFDLAWQYGP CTGITRLQRWHRAEQMGLEPPPEVRQVLCAHPGDPRFQCSLWHLYPL NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgggccggaaacggctcatcactgactcctaccctgtagtgaagaggagggagagcccc gctgggcacagcaagcgggagctggcaccagagctaggggaagagccccagcccctgagc gtggatgaagcggagctggagctgctgaggcagtttgacctggcctggcagtatgggccc tgcacagggatcacacggctgcagcgctggcatcgggcagagcagatgggcttggagcct cccccagaagtccgtcaggtgctgtgtgcccaccctggagatccccgcttccagtgcagc ctttggcatctctatcccctttga

DBGET integrated database retrieval system