Vicugna pacos (alpaca): 102545028
Help
Entry
102545028 CDS
T08098
Symbol
PSMD7
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7
KO
K03038
26S proteasome regulatory subunit N8
Organism
vpc
Vicugna pacos (alpaca)
Pathway
vpc03050
Proteasome
vpc05010
Alzheimer disease
vpc05012
Parkinson disease
vpc05014
Amyotrophic lateral sclerosis
vpc05016
Huntington disease
vpc05017
Spinocerebellar ataxia
vpc05020
Prion disease
vpc05022
Pathways of neurodegeneration - multiple diseases
vpc05169
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:
vpc00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
102545028 (PSMD7)
09160 Human Diseases
09172 Infectious disease: viral
05169 Epstein-Barr virus infection
102545028 (PSMD7)
09164 Neurodegenerative disease
05010 Alzheimer disease
102545028 (PSMD7)
05012 Parkinson disease
102545028 (PSMD7)
05014 Amyotrophic lateral sclerosis
102545028 (PSMD7)
05016 Huntington disease
102545028 (PSMD7)
05017 Spinocerebellar ataxia
102545028 (PSMD7)
05020 Prion disease
102545028 (PSMD7)
05022 Pathways of neurodegeneration - multiple diseases
102545028 (PSMD7)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03051 Proteasome [BR:
vpc03051
]
102545028 (PSMD7)
Proteasome [BR:
vpc03051
]
Eukaryotic proteasome
Regulatory particles
PA700 (19S proteasome)
non-ATPase subunits
102545028 (PSMD7)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
MitMem_reg
JAB
Connexin
Coilin_N
Motif
Other DBs
NCBI-GeneID:
102545028
NCBI-ProteinID:
XP_006203818
UniProt:
A0A6I9I5E8
LinkDB
All DBs
Position
9
AA seq
324 aa
AA seq
DB search
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDV
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEDSKKDR
KDDKEKEKDKEKSDIKKEEKKEKK
NT seq
975 nt
NT seq
+upstream
nt +downstream
nt
atgccggagctggcggtgcagaaagtggtggtccaccccctggtgctgctcagtgtggtg
gatcatttcaaccgaataggcaaggttggaaaccagaagcgtgttgttggtgtgcttttg
gggtcatggcaaaagaaagtactcgatgtatccaacagttttgcagtcccttttgatgaa
gacgacaaagatgattctgtctggtttttagaccatgattatttggaaaacatgtatgga
atgtttaagaaggtcaatgccagagaaagaatagttgggtggtaccacacaggccctaaa
ctacacaagaatgacatcgccatcaacgaactcatgaaacgatactgccctaactcagta
ttggtcattatagacgtgaaaccaaaggacctgggactgcccacggaagcatatatttca
gtggaagaagttcatgatgatggaaccccaacctcaaaaacatttgagcatgtgaccagt
gaaattggagcagaggaagccgaggaagttggagtggaacacttgttacgagacatcaaa
gacactacagtgggcactctttcccagcgaatcacaaaccaggtccatggtttgaaggga
ctcaactctaagcttctggatatcaggagctacctggagaaagtggccacgggcaagctg
cccatcaaccaccagatcatctaccagctgcaggacgtcttcaacctgctgccagatgtg
agcctgcaggagtttgtcaaggccttctacctgaagaccaacgaccagatggtggtggtg
tatttggcctcactgatccgttccgtggtcgccttgcacaacctcatcaacaacaagatt
gccaaccgggatgcagagaagaaagaagggcaggaaaaagaagacagcaagaaagataga
aaagatgacaaagagaaagagaaagataaggaaaagagtgatataaagaaagaagagaaa
aaggagaaaaagtaa
DBGET
integrated database retrieval system