Vicugna pacos (alpaca): 102545543 Help Entry 102545543         CDS       T08098                                  Name (RefSeq) histone H2B type F-M-like   KO K11252   histone H2B Organism vpc  Vicugna pacos (alpaca) Pathway vpc04613   Neutrophil extracellular trap formation vpc05034   Alcoholism vpc05203   Viral carcinogenesis vpc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:vpc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102545543  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102545543   09163 Immune disease    05322 Systemic lupus erythematosus     102545543   09165 Substance dependence    05034 Alcoholism     102545543  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vpc03036]     102545543   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vpc04147]     102545543 Chromosome and associated proteins [BR:vpc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102545543 Exosome [BR:vpc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102545543 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Flagellar_rod TAF DUF1931 MRP-S27 Motif Other DBs NCBI-GeneID:  102545543 NCBI-ProteinID:  XP_006219347 UniProt:  A0A6I9IS35 LinkDB All DBs Position Unknown AA seq 142 aa AA seqDB search MAEPWSSRTSEEIVDTEERKEAESKSPEQKTPKQETPVRRQRRRRRPADSFASFATYFRR VLKRVHTGLSLSREAVSVMDSFVKDIFERIASEAARLARSKNRVTITYEDIQSSVCLLLP GKFGKSAVSEGTNALIKYILCE NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atggctgagccgtggtcttcccgcacttcggaggagatcgtggacaccgaggagcgcaaa gaagccgagtccaagagcccagagcagaagacgccgaagcaggagacacccgtgcgccgc caacgccgccgccgccgcccagcagacagcttcgccagtttcgccacttacttccgcagg gtgctgaagcgggtgcacacaggcctgagcctctcgcgggaggccgtgagcgtcatggat tcgttcgttaaggacatcttcgagcgcatcgccagcgaggccgcgcgcctggcccgctcc aaaaaccgcgtcaccatcacctacgaagacatccagagctcggtgtgcctgctgctgcct gggaagttcggcaagtctgccgtgtccgagggcactaacgctctcatcaagtacatctta tgcgaatga

DBGET integrated database retrieval system