Vicugna pacos (alpaca): 102545754 Help Entry 102545754         CDS       T08098                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism vpc  Vicugna pacos (alpaca) Pathway vpc04145   Phagocytosis vpc04814   Motor proteins vpc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:vpc00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     102545754 (DYNLT1)   09142 Cell motility    04814 Motor proteins     102545754 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102545754 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:vpc03037]     102545754 (DYNLT1)    04812 Cytoskeleton proteins [BR:vpc04812]     102545754 (DYNLT1) Cilium and associated proteins [BR:vpc03037]  Motile cilia and associated proteins   Dynein arm    102545754 (DYNLT1) Cytoskeleton proteins [BR:vpc04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      102545754 (DYNLT1) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  102545754 NCBI-ProteinID:  XP_006197761 UniProt:  A0A6I9HWU1 LinkDB All DBs Position 8 AA seq 113 aa AA seqDB search MEDYQATEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggaagactaccaggctaccgaggagaccgcttttgttgttgatgaagtgagcaacatt gtaaaagaggccatagaaagtgcaatcggtggcaatgcctatcaacacagcaaagtgaat caatggaccacaaatgtagtagaacagactttaagccaactcaccaagctggggaaacca ttcaaatacatcgtgacctgtgttatcatgcagaagaacggagcggggttacacacggca agttcctgcttctgggacagctctactgacgggagctgcaccgtgcgatgggagaacaag accatgtactgcatcgtcagcgccttcggactgtctatctga

DBGET integrated database retrieval system