Vicugna pacos (alpaca): 107032840 Help Entry 107032840         CDS       T08098                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism vpc  Vicugna pacos (alpaca) Pathway vpc04613   Neutrophil extracellular trap formation vpc05034   Alcoholism vpc05203   Viral carcinogenesis vpc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:vpc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     107032840  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     107032840   09163 Immune disease    05322 Systemic lupus erythematosus     107032840   09165 Substance dependence    05034 Alcoholism     107032840  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vpc03036]     107032840 Chromosome and associated proteins [BR:vpc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     107032840 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  107032840 NCBI-ProteinID:  XP_015107249 UniProt:  A0A6J3BDP1 LinkDB All DBs Position 20 AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaaaggcggcaagggtctcggtaagggtggtgctaagcgccaccgc aaagttctgcgcgacaacatccagggtatcaccaagcccgccattcggcgtctggctcgg cgaggtggtgtgaagcgcatctccggcctcatctacgaggagacccgcggggtgctgaag gtgttcctagagaacgtgatccgggacgccgtcacctacaccgagcacgccaagcgcaag actgtcacagccatggacgtggtctacgcgctcaagcgccagggacgcacgctctacggc ttcggcggttag

DBGET integrated database retrieval system