Vicugna pacos (alpaca): 116280218 Help Entry 116280218         CDS       T08098                                  Name (RefSeq) interferon alpha-1-like   KO K05414   interferon alpha Organism vpc  Vicugna pacos (alpaca) Pathway vpc04060   Cytokine-cytokine receptor interaction vpc04151   PI3K-Akt signaling pathway vpc04217   Necroptosis vpc04620   Toll-like receptor signaling pathway vpc04621   NOD-like receptor signaling pathway vpc04622   RIG-I-like receptor signaling pathway vpc04623   Cytosolic DNA-sensing pathway vpc04630   JAK-STAT signaling pathway vpc04650   Natural killer cell mediated cytotoxicity vpc04936   Alcoholic liver disease vpc05152   Tuberculosis vpc05160   Hepatitis C vpc05161   Hepatitis B vpc05162   Measles vpc05163   Human cytomegalovirus infection vpc05164   Influenza A vpc05165   Human papillomavirus infection vpc05167   Kaposi sarcoma-associated herpesvirus infection vpc05168   Herpes simplex virus 1 infection vpc05169   Epstein-Barr virus infection vpc05170   Human immunodeficiency virus 1 infection vpc05171   Coronavirus disease - COVID-19 vpc05200   Pathways in cancer vpc05320   Autoimmune thyroid disease vpc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:vpc00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     116280218    04151 PI3K-Akt signaling pathway     116280218   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     116280218  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     116280218  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     116280218    04621 NOD-like receptor signaling pathway     116280218    04622 RIG-I-like receptor signaling pathway     116280218    04623 Cytosolic DNA-sensing pathway     116280218    04650 Natural killer cell mediated cytotoxicity     116280218  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116280218   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     116280218    05161 Hepatitis B     116280218    05160 Hepatitis C     116280218    05171 Coronavirus disease - COVID-19     116280218    05164 Influenza A     116280218    05162 Measles     116280218    05168 Herpes simplex virus 1 infection     116280218    05163 Human cytomegalovirus infection     116280218    05167 Kaposi sarcoma-associated herpesvirus infection     116280218    05169 Epstein-Barr virus infection     116280218    05165 Human papillomavirus infection     116280218   09171 Infectious disease: bacterial    05152 Tuberculosis     116280218   09163 Immune disease    05320 Autoimmune thyroid disease     116280218   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116280218   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     116280218  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vpc04052]     116280218 Cytokines and neuropeptides [BR:vpc04052]  Cytokines   Interferons    116280218 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  116280218 NCBI-ProteinID:  XP_031532874 UniProt:  A0A6J3AGJ4 LinkDB All DBs Position 4 AA seq 187 aa AA seqDB search MSPMARPLSVLMALVALSCHSICSLGCDLPQTHSLATRRTLMLLGQMRRISPSSCLKDRQ DFGFPQEVLGGHRLQKAQAISVFHEVVQQLFLLFSTEGSSAAWEEGLLHRLCTGLDQQLT ELEACPMQEAGLQGSPLLNEDPILAVRRYFHRITLYLQEKKYSPCAWEIVRAEVMRSFSS ARHLQER NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgtccccaatggctcgacccttgtctgtactcatggccctggtggcgctcagctgtcac tccatctgctcgctggggtgtgacctgcctcagacccacagcctggccaccaggaggacc ttgatgctcctgggacaaatgaggagaatctccccctcctcctgcctgaaggacagacag gactttggattccctcaggaggtccttggtggccaccggctccagaaggctcaagccatc tctgtcttccatgaggtggtccagcagctcttcctcctcttcagcacagagggctcgtct gctgcctgggaggagggcctcctgcacagactctgcactgggcttgatcagcagctgacg gagctggaagcctgtccgatgcaggaggcggggctgcaagggtcccccctgctgaatgag gaccccatcctggctgtgaggagatacttccacagaatcactctctatctgcaagagaag aaatacagtccttgtgcctgggagatcgtcagagcagaagtcatgagatccttctcttca gcgagacacttgcaagaaagatga

DBGET integrated database retrieval system