Vicugna pacos (alpaca): 116280272 Help Entry 116280272         CDS       T08098                                  Name (RefSeq) claudin-18-like   KO K06087   claudin Organism vpc  Vicugna pacos (alpaca) Pathway vpc03272   Virion - Hepatitis viruses vpc04382   Cornified envelope formation vpc04514   Cell adhesion molecules vpc04530   Tight junction vpc04670   Leukocyte transendothelial migration vpc05160   Hepatitis C Brite KEGG Orthology (KO) [BR:vpc00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     116280272  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     116280272  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     116280272  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     116280272   09158 Development and regeneration    04382 Cornified envelope formation     116280272  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     116280272  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:vpc03037]     116280272    04147 Exosome [BR:vpc04147]     116280272    04515 Cell adhesion molecules [BR:vpc04515]     116280272 Cilium and associated proteins [BR:vpc03037]  Other cilia and associated proteins   Stereociliary proteins    116280272 Exosome [BR:vpc04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    116280272   Exosomal proteins of colorectal cancer cells    116280272 Cell adhesion molecules [BR:vpc04515]  Immunoglobulin superfamily   L1 family    116280272 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Motif Other DBs NCBI-GeneID:  116280272 NCBI-ProteinID:  XP_031532998 UniProt:  A0A6J3AHG9 LinkDB All DBs Position 1 AA seq 154 aa AA seqDB search MSVTACQGLGFVVSLIGIAGIIAATCMDQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGF TECRGYFTILGLPVRSGQVVFRGEQSLKDGLVGALSGAFSPGGGALGRSPTWDGAEVHSD RRALKLAETRPLSGTSASWAASLTNEKIMPLNLE NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgtctgtgaccgcctgccagggcttggggtttgtggtctcactgatcggcattgcgggc atcattgctgccacctgcatggaccagtggagcacccaggatttatacaacaacccggtg acagccgtcttcaactaccagggcctgtggcgctcctgtgtccgcgagagctccggcttc accgagtgccggggctacttcaccatcctggggctgccagtgaggtcaggccaagtggtt ttccgtggtgagcagagcctcaaggacgggcttgtgggggctctcagcggtgccttttcc ccgggtggtggcgcgctcgggcgcagcccgacctgggatggggcggaggtccactcagac cgccgcgccctcaaactagctgagactcggccgctcagcgggacaagtgcctcttgggct gcttcgctaacaaatgaaaaaataatgcccttgaatctggagtga

DBGET integrated database retrieval system