Variovorax paradoxus B4: VAPA_1c19410 Help Entry VAPA_1c19410      CDS       T02835                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism vpd  Variovorax paradoxus B4 Pathway vpd01100   Metabolic pathways vpd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vpd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VAPA_1c19410    00074 Mycolic acid biosynthesis     VAPA_1c19410   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VAPA_1c19410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AGU49047 UniProt:  T1X7Y5 LinkDB All DBs Position 1:complement(2067810..2068052) Genome browser AA seq 80 aa AA seqDB search MSSLKELQDLIHEKYGIEPSKLDPNASMRETGGLDSLALAEFLFAIEDHFGITMPDEDAN IDTLNELAVLVDKVRAAKTA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagttcgctgaaggaattgcaggacctgatccacgagaagtacggtatcgaaccgtcg aaactcgaccccaacgcatcgatgcgcgaaaccggcgggctcgactcgctggcattggcc gagttcctgtttgccatcgaagaccacttcggcatcaccatgcccgacgaagacgccaac atcgacaccctgaacgaactggcggtgctggtcgacaaggtcagggccgcgaagacagcg tga

DBGET integrated database retrieval system