Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_06485 Help Entry M634_06485        CDS       T02761                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31 Pathway vpf01100   Metabolic pathways vpf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vpf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M634_06485    00074 Mycolic acid biosynthesis     M634_06485   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M634_06485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AGQ90441 LinkDB All DBs Position I:complement(1325572..1325832) Genome browser AA seq 86 aa AA seqDB search MEQLHNDIKQLIINALNLEDLTVDDIETDAPLFGDGLGLDSIDALELGLAIKKQYNIVID ADDSNTREHFASVANLAKYVSSQTNE NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtggaacagttacacaacgatattaagcaacttattattaatgctttgaaccttgaagat ttaaccgtagacgatattgaaacggatgcgccactttttggtgatggacttggcttagac tctatcgacgcacttgagcttggattagcaattaaaaagcaatacaacatcgtcatcgat gctgacgactcaaatacgcgcgaacactttgcttctgtagcaaacctagcgaaatacgtt tcttctcaaaccaatgaataa

DBGET integrated database retrieval system