Vibrio pelagius: LZI70_06070 Help Entry LZI70_06070       CDS       T08558                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism vpg  Vibrio pelagius Pathway vpg01100   Metabolic pathways vpg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vpg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LZI70_06070    00074 Mycolic acid biosynthesis     LZI70_06070   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LZI70_06070 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding IF2_N DUF7215 Motif Other DBs NCBI-ProteinID:  UTT85808 LinkDB All DBs Position 1:complement(1410609..1410839) Genome browser AA seq 76 aa AA seqDB search MNTKESVKELIAKVLNVSVSVVDDELAVGDIPEWDSLAHMRIIAALESDLGVVLDIEQTL EIEDVEDIIEAVLNNE NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgaatacaaaagagtcagtaaaagaacttatcgctaaagtcctaaacgtatcagttagc gttgttgatgatgagttagcagttggcgatattcctgaatgggattctcttgctcacatg cgcattattgctgcgttagaatcagatttaggcgtagtgctagatattgagcagacgtta gagatcgaagatgtagaagacattatcgaagctgttttaaacaacgagtag

DBGET integrated database retrieval system