Vibrio pelagius: LZI70_08115 Help Entry LZI70_08115       CDS       T08558                                  Symbol zapB Name (GenBank) cell division protein ZapB   KO K09892   cell division protein ZapB Organism vpg  Vibrio pelagius Brite KEGG Orthology (KO) [BR:vpg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vpg03036]     LZI70_08115 (zapB) Chromosome and associated proteins [BR:vpg03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     LZI70_08115 (zapB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Nuf2_DHR10-like PspA_IM30 YabA DUF3450 Dynamin-like_hel_bact Dor1 APG6_N DUF7491 betaPIX_CC Syntaxin ERM_helical CENP-F_leu_zip CCDC113_CCDC96_CC GAS NUDE_C ATG16 Muted TMF_TATA_bd CCDC106 Mis12 Ax_dynein_light CtIP_N CsiV Mod_r DUF2203 HALZ Tup_N DUF4337 UPF0242 HAUS-augmin3 DUF1664 DUF724 Spc7 bZIP_1 DivIC Herpes_UL6 TMF_DNA_bd NPV_P10 YwqH-like Spectrin Seryl_tRNA_N FapA AAA_13 ADIP DUF4795 OmpH CENP-Q LCD1 Sipho_Gp157 Occludin_ELL GrpE ATG14 Prominin DUF948 DUF349 JIP_LZII 5_nucleotid DNA_topoisoIV TMPIT Motif Other DBs NCBI-ProteinID:  UTT83681 LinkDB All DBs Position 1:1844196..1844438 Genome browser AA seq 80 aa AA seqDB search MSFEVLEQLEAKIQTAVDTIALLQMEVEELKEEKQQLAAEAGELKASREELEQKTQQMQQ EHAAWQDRIRSLLGKMDEVE NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtcttttgaagtactagagcaactagaagcaaaaattcaaacagcagttgatactatt gcacttctgcaaatggaagtagaagagctaaaagaagagaagcagcagctagcggcagaa gctggtgagctaaaagcaagccgtgaagagctagagcaaaaaactcagcaaatgcagcaa gaacatgcagcatggcaagaccgcattcgcagcctactaggcaagatggacgaagttgag taa

DBGET integrated database retrieval system