Vanderwaltozyma polyspora: Kpol_1004p26 Help Entry Kpol_1004p26      CDS       T01049                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism vpo  Vanderwaltozyma polyspora Pathway vpo04814   Motor proteins Brite KEGG Orthology (KO) [BR:vpo00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     Kpol_1004p26  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:vpo03037]     Kpol_1004p26    04812 Cytoskeleton proteins [BR:vpo04812]     Kpol_1004p26 Cilium and associated proteins [BR:vpo03037]  Motile cilia and associated proteins   Dynein arm    Kpol_1004p26 Cytoskeleton proteins [BR:vpo04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      Kpol_1004p26 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  5545891 NCBI-ProteinID:  XP_001645510 UniProt:  A7TJ83 LinkDB All DBs AA seq 92 aa AA seqDB search MSSNSNLTPVLKSSDISDEIKDEIFKISLDAVEKYQLERDLAGAIKKQLDVKYGNTWHVI AGKSFGSYVTHEKGHFIYFYIGPTAFLVFKTA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgagttctaattccaatttgaccccagttttgaagtcgtcagatatctctgatgaaata aaggatgagatcttcaagataagtttagatgctgtggagaaataccagctggaacgtgat cttgccggagctattaagaagcaattggatgttaaatatggtaatacttggcatgtaatt gccggtaaaagttttggaagttatgtcactcatgaaaagggccatttcatttacttttac atcggtccaactgccttcctggtgttcaagactgcttaa

DBGET integrated database retrieval system