KEGG   Vanderwaltozyma polyspora: Kpol_367p5
Entry
Kpol_367p5        CDS       T01049                                 
Name
(RefSeq) hypothetical protein
  KO
K06646  G1/S-specific cyclin CLN3
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo04111  Cell cycle - yeast
vpo04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:vpo00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    Kpol_367p5
   04113 Meiosis - yeast
    Kpol_367p5
SSDB
Motif
Pfam: Cyclin_N DUF2291
Other DBs
NCBI-GeneID: 5543098
NCBI-ProteinID: XP_001642908
UniProt: A7TRQ6
LinkDB
AA seq 562 aa
MNVSTTTIINNDNVKVVDSLPNLHHLAHIRRNVARSKAANPSLLKNQFNVHRISVLEYSK
SLLNHLIRLEDSTNLEYPLIINNFKAQPQINDKMRNLIIDFIICCHTRLKLSSSTLFLTI
DLLNRYSSKFIIKCNNYQLFALTALWISSKYWDSKNKIPNFNILTSLCCNQFTPTQFKEI
EWHLLTSLNWSILQNPTTDYFIDLLLVIDNNNSSQNLNPIYWKNSNLNLNEIKSGAILLA
ELASFDLNLSFSYNSSAIALASITLITLALNFHDLNNWENYHVDSKDANLNKICDKLLFL
ATDKDAFPSSFKFKYLNDQQKNSTTAAVTNTNLNNGNKILTALSNYYLQLQFEEFYNSQE
FNNLANSINDNLINDQNIMHSNNEFMKTNQDSSSNCMKGRMNIYSNHSNYNDKHYNNSNI
NITNNSPHSVSSSTSSSAISTFASPDSAMTAESDKEISSSTSSLLPNSLLLLPLTPTTPT
LFQVDTKSSEKKRLMTLNSINNNNNFSKQDNQASARSNPIVNIPASSGIRTFVKGHIKRS
SSSMDIDFFDTDMDYKRNPNRY
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgaatgtttcaacaactacaattattaacaatgataatgttaaggtcgtcgattcctta
ccaaatttacaccatttggcccatataagaagaaatgttgctagatcaaaagctgctaac
ccaagtctattaaaaaatcaattcaatgttcatagaatctccgtcttagaatacagtaaa
tctttattaaaccatttaattagattagaagattcgacaaatttagaatacccattaatt
attaataacttcaaagctcaaccacagatcaacgacaaaatgagaaacttaatcatagat
ttcataatttgttgtcacacaagattaaagttatcatcttcaactttgtttttaaccatt
gatttattgaatagatattcctccaaatttattatcaagtgtaacaattatcaattgttt
gccttaactgcattatggatttcatcaaaatattgggattccaaaaataaaattccaaat
tttaacattttaacaagtttatgttgtaatcaatttactcctacacaatttaaagaaatt
gaatggcatctattaacttcattgaattggtcaattttacaaaatccaacaactgattat
tttattgatttattattagttatcgataataataatagcagtcaaaatttaaatccaatt
tattggaaaaactcaaatttaaatttaaatgaaattaaatctggagctatcctattagca
gaattagcatcctttgatttgaacctatcatttagttataattcatctgcaattgcattg
gcttcaattacattaattactttagcattgaatttccatgatttaaataactgggaaaat
tatcatgttgattctaaagatgccaatttaaataagatttgtgataaattattattttta
gctaccgataaggatgctttcccatcttcttttaaatttaagtatttgaacgatcaacaa
aaaaattctacaacagctgctgttaccaacaccaatttgaataacggaaataaaatatta
acagctttatcaaattattatttgcaattgcaatttgaagagttttacaattctcaagaa
tttaacaatttggcaaattcaatcaatgataatttaattaatgatcaaaatattatgcat
tcaaataacgaatttatgaaaacaaatcaagattcatctagtaattgcatgaagggaaga
atgaatatttacagtaatcatagtaattataatgacaaacattacaataacagtaatatt
aatattactaacaattctcctcattcagtttcatcttcaacttcctcttctgcaatttca
acctttgcatctccggattctgctatgactgcagaatctgataaagaaatatcatcttcc
acttcatcactgttgccaaattcattattgttattaccattaactccaacaactccaaca
ttatttcaagtcgataccaaatctagtgagaaaaagagattaatgacactaaattcaatc
aataataacaataatttttctaaacaagataatcaagcaagtgcaagatcaaatccaata
gtaaatatacctgctagttcaggaattagaacttttgttaaaggacatatcaaaagatca
tcttcttcaatggatattgatttttttgatactgatatggattacaaacgtaaccctaac
agatattaa

DBGET integrated database retrieval system