Vanderwaltozyma polyspora: Kpol_495p16 Help Entry Kpol_495p16       CDS       T01049                                  Name (RefSeq) hypothetical protein   KO K14531   ribonuclease MRP protein subunit SNM1 Organism vpo  Vanderwaltozyma polyspora Pathway vpo03008   Ribosome biogenesis in eukaryotes Brite KEGG Orthology (KO) [BR:vpo00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     Kpol_495p16  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:vpo03009]     Kpol_495p16    03029 Mitochondrial biogenesis [BR:vpo03029]     Kpol_495p16 Ribosome biogenesis [BR:vpo03009]  Eukaryotic type   Pre-60S particles    RNases     RNase MRP      Kpol_495p16 Mitochondrial biogenesis [BR:vpo03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial transcription and translation factors    RNase MRP     Kpol_495p16 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Rpr2 Motif Other DBs NCBI-GeneID:  5544139 NCBI-ProteinID:  XP_001643876 UniProt:  A7TNZ3 LinkDB All DBs AA seq 59 aa AA seqDB search MNRDQFEKFRDRQIRKKYDLVHMVPHLGIPELSGVYLKNFYNSCKRYEVVLPTNITASK NT seq 180 nt NT seq  +upstreamnt  +downstreamnt atgaatagagatcaatttgaaaaatttagagatagacaaatacgaaaaaagtatgatttg gttcatatggtgccacatttaggtatacctgaactatctggagtatacttaaagaatttt tataattcttgtaaaaggtatgaagttgtgttgccaacaaatataactgcatcaaaatga

DBGET integrated database retrieval system