Virgibacillus pantothenticus: KBP50_21195 Help Entry KBP50_21195       CDS       T07430                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism vpt  Virgibacillus pantothenticus Pathway vpt00998   Biosynthesis of various antibiotics vpt01100   Metabolic pathways vpt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vpt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KBP50_21195 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KBP50_21195 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 FtsX_ECD Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QTY16287 LinkDB All DBs Position 4585472..4585681 Genome browser AA seq 69 aa AA seqDB search MSNMLDIPKDEITELTEFKEDLGLDSLDLVELIMELEEEFDITIEDEDASKFTTVNDALS HINDLLNNN NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgtcaaatatgttagatattcccaaagatgaaataacagaattaacagaatttaaagaa gatctcggattagattctttagatttagtagaattaattatggaattagaagaggaattt gacataacaatagaagatgaagacgcaagcaagttcacaaccgtaaatgatgctctgtca catataaatgatttacttaacaataactaa

DBGET integrated database retrieval system