Vallitalea pronyensis: HZI73_20590 Help Entry HZI73_20590       CDS       T07178                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism vpy  Vallitalea pronyensis Pathway vpy00020   Citrate cycle (TCA cycle) vpy00720   Other carbon fixation pathways vpy01100   Metabolic pathways vpy01110   Biosynthesis of secondary metabolites vpy01120   Microbial metabolism in diverse environments vpy01200   Carbon metabolism vpy01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:vpy00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     HZI73_20590   09102 Energy metabolism    00720 Other carbon fixation pathways     HZI73_20590 Enzymes [BR:vpy01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      HZI73_20590 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4_6 Fer4 Fer4_21 Fer4_2 Fer4_10 LdpA_Fe-S-bd Fer4_4 Fer4_9 Fer4_15 Fer4_8 Fer4_16 Fer4_22 Fer4_17 Fer4_3 Fer4_13 Motif Other DBs NCBI-ProteinID:  QUI24551 UniProt:  A0A8J8SIG1 LinkDB All DBs Position complement(4950059..4950265) Genome browser AA seq 68 aa AA seqDB search MAKVTFKEDLCKGCGLCTTVCPKKIIHLAEGKINGKGYHPATVIEMDKCIGCAFCATICP DVVITVER NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggcaaaagtaacatttaaagaggatttatgtaaaggttgtgggttgtgtaccaccgta tgtcctaaaaagattatccacctagctgaggggaaaattaatggtaaaggctaccatcca gctacagtcatagaaatggataaatgtattggatgcgctttttgtgccacaatctgtcca gatgtggttataacagttgaaagatag

DBGET integrated database retrieval system