Vibrio qinghaiensis: CCZ37_01180 Help Entry CCZ37_01180       CDS       T05259                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism vqi  Vibrio qinghaiensis Pathway vqi02024   Quorum sensing vqi03018   RNA degradation vqi05111   Biofilm formation - Vibrio cholerae Brite KEGG Orthology (KO) [BR:vqi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     CCZ37_01180  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     CCZ37_01180    05111 Biofilm formation - Vibrio cholerae     CCZ37_01180  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:vqi03019]     CCZ37_01180    03036 Chromosome and associated proteins [BR:vqi03036]     CCZ37_01180 Messenger RNA biogenesis [BR:vqi03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      CCZ37_01180 Chromosome and associated proteins [BR:vqi03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     CCZ37_01180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  ASU21307 UniProt:  A0A223MVF5 LinkDB All DBs Position 1:236026..236292 Genome browser AA seq 88 aa AA seqDB search MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAIS TVVPARAVSHHTAEPRTGSDRPSDKSEE NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctctacaagacccattcttaaatgcactacgtcgtgagcgcatt ccagtatccatctaccttgtgaacggaattaagcttcaaggtcagattgaatcctttgat caatttgtgatcttactgaaaaacacagtcaatcaaatggtgtataagcatgcgatttca acggttgttcctgcacgtgcagtgagccaccacactgctgagccacgcaccgggtctgat cgtccatcagacaaatcagaagagtaa

DBGET integrated database retrieval system