Vigna radiata (mung bean): 106757334 Help Entry 106757334         CDS       T04126                                  Name (RefSeq) sm-like protein LSM2   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism vra  Vigna radiata (mung bean) Pathway vra03018   RNA degradation vra03040   Spliceosome Brite KEGG Orthology (KO) [BR:vra00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     106757334   09123 Folding, sorting and degradation    03018 RNA degradation     106757334  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:vra03019]     106757334    03041 Spliceosome [BR:vra03041]     106757334 Messenger RNA biogenesis [BR:vra03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      106757334   mRNA degradation factors    5'-3' decay     Lsm complex      106757334 Spliceosome [BR:vra03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     106757334  Complex C   U2 snRNP components     106757334 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM SM-ATX DUF150_C DUF1256 Motif Other DBs NCBI-GeneID:  106757334 NCBI-ProteinID:  XP_014495462 UniProt:  A0A1S3TP13 LinkDB All DBs Position 3:867651..869823 Genome browser AA seq 93 aa AA seqDB search MLFFSYFKDLVGREVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNC FIRGSVVRYVQLPPEGVDIELLHDATRREARSG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgttgttcttctcgtacttcaaggatttggtgggaagagaagtaactgtagagctgaag aacgatttggccatcagagggacattgcattccgttgatcagtacctcaacatcaagctc gaaaacactcgcgtcgttgatcaagacaagtacccccacatgctttcagtaagaaactgc ttcatcagaggttcggtagtgagatacgtgcaattacctccagaaggggtggacattgaa ttgttgcacgatgccactaggagagaggctaggagcggttag

DBGET integrated database retrieval system