Vitis riparia (riverbank grape): 117904328 Help Entry 117904328         CDS       T07274                                  Name (RefSeq) protein MHF1 homolog isoform X1   KO K11511   centromere protein S Organism vri  Vitis riparia (riverbank grape) Pathway vri03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:vri00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     117904328  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vri03036]     117904328    03400 DNA repair and recombination proteins [BR:vri03400]     117904328 Chromosome and associated proteins [BR:vri03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      117904328 DNA repair and recombination proteins [BR:vri03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      117904328 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C TFIID-31kDa Bromo_TP Histone CBFD_NFYB_HMF DUF1175 Motif Other DBs NCBI-GeneID:  117904328 NCBI-ProteinID:  XP_034672766 LinkDB All DBs Position 17:20608816..20612018 Genome browser AA seq 135 aa AA seqDB search MEEARSELEREEDEEATELLRDRFRLSTISIVEAQAKKSDMEISEPIVACISDLAFKYTE QLAKDLELFSQHAGRKTVNMEDVILSAHRNKHLASSLRSFCNDLKAKEIPSERKRKKASR KEDKASTSVVHIPDL NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atggaagaagcgagaagcgaattggagagagaagaagatgaagaggctaccgagctccta agggaccgattccgactctccaccatctcaattgtggaagctcaagcgaagaaaagcgat atggaaatctcggagccgattgtggcctgcatttccgatttggccttcaaatatacagaa cagttggcaaaggaccttgagttattttctcagcatgcgggtcgtaagactgtcaacatg gaagatgtcatcctctctgcacatagaaacaaacatttagcctcctccttgaggtccttc tgcaatgatctcaaagcaaaagaaatcccatctgagaggaagcggaagaaagcatcaaga aaggaggacaaagcttccaccagcgtggtgcatattccagatctctaa

DBGET integrated database retrieval system