Vitis riparia (riverbank grape): 117908065 Help Entry 117908065         CDS       T07274                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism vri  Vitis riparia (riverbank grape) Brite KEGG Orthology (KO) [BR:vri00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:vri03041]     117908065   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vri04052]     117908065 Spliceosome [BR:vri03041]  Complex B   Other components    Complex B specific factors     117908065 Cytokines and neuropeptides [BR:vri04052]  Neuropeptides   Unclassified    117908065 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 OTU1_UBXL Rad60-SLD Ubiquitin_4 Motif Other DBs NCBI-GeneID:  117908065 NCBI-ProteinID:  XP_034677613 LinkDB All DBs Position 19:complement(6972985..6975101) Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNDDDTIGDLKKLVAAQTGTRSDKIRIQKWYTIYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtgttgaacgatcggttggggaagaaggtgagggtgaagtgcaacgac gacgacactatcggtgacctcaagaagctggtggctgctcagaccggcaccagatccgac aagatcaggattcagaagtggtacaccatttacaaggaccacatcaccctcaaggactac gagatccacgacggcatgggcctcgagctctactacaactag

DBGET integrated database retrieval system