Vitis riparia (riverbank grape): 117911213 Help Entry 117911213         CDS       T07274                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism vri  Vitis riparia (riverbank grape) Pathway vri04145   Phagosome vri04148   Efferocytosis vri04620   Toll-like receptor signaling pathway vri05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:vri00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     117911213    04148 Efferocytosis     117911213  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     117911213  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     117911213  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vri04131]     117911213   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vri04147]     117911213    04031 GTP-binding proteins [BR:vri04031]     117911213 Membrane trafficking [BR:vri04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     117911213  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     117911213   Macropinocytosis    Ras GTPases     117911213  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     117911213 Exosome [BR:vri04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    117911213   Exosomal proteins of other body fluids (saliva and urine)    117911213   Exosomal proteins of colorectal cancer cells    117911213   Exosomal proteins of bladder cancer cells    117911213 GTP-binding proteins [BR:vri04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     117911213 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  117911213 NCBI-ProteinID:  XP_034681370 LinkDB All DBs Position 3:1490699..1495286 Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFIDHPGAVPITTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKRKKRKAQKSCSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcttcaaggttcatcaagtgcgtcactgtcggtgacggcgccgtcggcaagact tgcatgctcatctcctacaccagcaacactttccccacggattatgtgccaactgtattt gacaatttcagtgcaaatgttgtggtggatgggagcactgttaatctagggttgtgggat actgcaggccaggaggattacaataggttgagacctttgagctaccgtggtgcagatgtc tttctgcttgctttctccctcattagcaaggctagctatgaaaatgttgccaagaaatgg attcctgagttgaggcattatgcacctggtgttccaataattcttgtcgggacaaagctt gatcttcgagatgataagcagttcttcatagatcaccctggtgcagtgcccattaccaca gctcagggagaggaactgagaaagctgattggagctcctgcttacattgaatgtagttca aaaacacagcagaacgtgaaggctgtctttgatgcggccattaaggtggttctccagcca ccaaagcagaagaagagaaagaagagaaaggcacagaaatcttgttctatattgtga

DBGET integrated database retrieval system