Vitis riparia (riverbank grape): 117913453 Help Entry 117913453         CDS       T07274                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism vri  Vitis riparia (riverbank grape) Pathway vri03083   Polycomb repressive complex vri04120   Ubiquitin mediated proteolysis vri04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:vri00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     117913453    04120 Ubiquitin mediated proteolysis     117913453   09126 Chromosome    03083 Polycomb repressive complex     117913453  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vri04131]     117913453    04121 Ubiquitin system [BR:vri04121]     117913453    03036 Chromosome and associated proteins [BR:vri03036]     117913453 Membrane trafficking [BR:vri04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     117913453 Ubiquitin system [BR:vri04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      117913453    Cul7 complex      117913453 Chromosome and associated proteins [BR:vri03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      117913453   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      117913453 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Nse4-Nse3_bdg Motif Other DBs NCBI-GeneID:  117913453 NCBI-ProteinID:  XP_034684326 LinkDB All DBs Position 4:21014441..21016343 Genome browser AA seq 154 aa AA seqDB search MASRKVNLMSSDGVTFEVDDIVALELQTIKHMIEAGFSDGAIPLPNVTSGILAMVIEYCK MHVESSKSEDRSADDNLKAWDAEFVKVDVATLFHLIMAANYLNIQSLLELTCQTVADMMK GKSVEYIRKTFNITNDYTPEEEEEIRREFPWVFE NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atggcgtcgaggaaggtgaacttgatgagctccgatggcgtgacgttcgaagtggacgac atcgtggcgttggagttgcagacgatcaagcacatgatcgaggccggtttttccgacggc gccattcctctcccgaacgtcaccagcggtatccttgcgatggtgatcgagtactgcaag atgcacgtggagagttccaagtccgaggatcgcagcgccgatgataacctcaaggcctgg gatgccgaattcgtcaaggttgatgtggctactctgtttcatctcatcatggctgccaat tatttgaacatccagagcttgctggagctaacatgccagacagttgcagacatgatgaag ggaaagtccgtagagtacatacgcaagaccttcaacattacaaatgattacactccagag gaggaggaagagatccgtcgggaattcccctgggtttttgaatga

DBGET integrated database retrieval system