Vitis riparia (riverbank grape): 117915389 Help Entry 117915389         CDS       T07274                                  Name (RefSeq) sm-like protein LSM5   KO K12624   U6 snRNA-associated Sm-like protein LSm5 Organism vri  Vitis riparia (riverbank grape) Pathway vri03018   RNA degradation vri03040   Spliceosome Brite KEGG Orthology (KO) [BR:vri00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     117915389   09123 Folding, sorting and degradation    03018 RNA degradation     117915389  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:vri03019]     117915389    03041 Spliceosome [BR:vri03041]     117915389 Messenger RNA biogenesis [BR:vri03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      117915389   mRNA degradation factors    5'-3' decay     Lsm complex      117915389 Spliceosome [BR:vri03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     117915389 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM DUF7452 Ntox4 Motif Other DBs NCBI-GeneID:  117915389 NCBI-ProteinID:  XP_034686856 LinkDB All DBs Position 5:12824077..12837083 Genome browser AA seq 87 aa AA seqDB search MSTNPSQLLPSELIDRCIGSKIWVIMKGDKELVGTLRGFDVYVNMVLEDVTEYEITSEGR RITKLDQILLNGNNIAILVPGGSPDPE NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgtcgacgaatccctctcaactccttccatcagagctgattgatcggtgcatagggtcg aaaatatgggtgataatgaaaggggacaaagagcttgttggaaccctaaggggattcgat gtctacgtgaatatggttctggaagacgtgactgaatacgaaatcacctctgaaggtcgg agaatcacgaaattggatcagatcttgctgaacgggaacaatattgccattctggttcct ggtgggtctcctgatccagaatga

DBGET integrated database retrieval system