Vitis riparia (riverbank grape): 117922729 Help Entry 117922729         CDS       T07274                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism vri  Vitis riparia (riverbank grape) Pathway vri04136   Autophagy - other Brite KEGG Orthology (KO) [BR:vri00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     117922729  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vri04131]     117922729    04121 Ubiquitin system [BR:vri04121]     117922729    03029 Mitochondrial biogenesis [BR:vri03029]     117922729 Membrane trafficking [BR:vri04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     117922729 Ubiquitin system [BR:vri04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    117922729 Mitochondrial biogenesis [BR:vri03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     117922729 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  117922729 NCBI-ProteinID:  XP_034696828 LinkDB All DBs Position 9:complement(1087822..1090882) Genome browser AA seq 94 aa AA seqDB search MASESPSSARKVVVHLRATGDAPILKQAKFKIPGTDKFAKVIEFLRRQLHRDTLFVYVNS AFSPNPDELVIDLYNNFGFDGKLVVNYACSMAWG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggcttctgaatctccaagctctgcacgtaaagttgttgttcatctgagagccactggt gatgcgcctatactcaagcaggccaagttcaagattcctggaactgacaaatttgctaaa gtgattgaatttcttcgcagacaactacacagggacacattgtttgtatatgtcaacagt gcattctcaccaaacccagatgaattggtgattgatttgtataataatttcggttttgat ggtaaactggtggtaaattatgcttgttcgatggcatggggttga

DBGET integrated database retrieval system