Vibrio rotiferianus: BSZ04_18625 Help Entry BSZ04_18625       CDS       T05115                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism vro  Vibrio rotiferianus Brite KEGG Orthology (KO) [BR:vro00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:vro03032]     BSZ04_18625    03036 Chromosome and associated proteins [BR:vro03036]     BSZ04_18625    03400 DNA repair and recombination proteins [BR:vro03400]     BSZ04_18625 DNA replication proteins [BR:vro03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BSZ04_18625 Chromosome and associated proteins [BR:vro03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BSZ04_18625 DNA repair and recombination proteins [BR:vro03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BSZ04_18625 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 ACP_syn_III_C DUF7342 Motif Other DBs NCBI-ProteinID:  ASI96942 UniProt:  A0A2K7SYK7 LinkDB All DBs Position 2:complement(2112258..2112530) Genome browser AA seq 90 aa AA seqDB search MNKTQLVEKIAENADISKASAGRALDAFIEAVGGTLQSGDQVALVGFGTFSVRTRAARTG RNPKTGEEIQIAEAKVPSFKAGKALKDACN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaataaaactcaattagtagaaaaaatcgcagaaaatgcagacatctctaaagcgtca gctggccgtgctctagatgcattcatcgaagctgttggtggcacactgcaatcaggtgac caagttgctttagttggcttcggtacttttagcgttcgcactcgtgcagctcgcactggc cgtaaccctaagactggtgaagagatccaaatcgcagaagcgaaagttccttcattcaaa gctggtaaagctctaaaagatgcttgtaactaa

DBGET integrated database retrieval system