Vibrio rotiferianus: BSZ04_21890
Help
Entry
BSZ04_21890 CDS
T05115
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
vro
Vibrio rotiferianus
Pathway
vro03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
vro00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
BSZ04_21890
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
vro03011
]
BSZ04_21890
Ribosome [BR:
vro03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
BSZ04_21890
Bacteria
BSZ04_21890
Archaea
BSZ04_21890
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Ribosomal_L5e
TM1506
Motif
Other DBs
NCBI-ProteinID:
ASI97531
LinkDB
All DBs
Position
2:complement(2819188..2819541)
Genome browser
AA seq
117 aa
AA seq
DB search
MDKKASRIRRATRARRKIAELGATRLVVHRTPRHVYAQVIAANGSEVIAAASTVEKAIRE
QVKYTGNVDAAKAVGKAVAERALEKGVTAVAFDRSGFQYHGRVAALAESAREAGLKF
NT seq
354 nt
NT seq
+upstream
nt +downstream
nt
atggataagaaagcatctcgcatccgtcgtgctacacgtgcacgtcgtaagattgcagaa
ctgggtgcgactcgcctagttgtacaccgtactcctcgtcacgtgtacgcacaggttatc
gcggctaatggctctgaggttatcgcagcagcttctactgtagaaaaagcgatccgtgag
caagtgaaatacactggtaacgttgatgcagctaaagcagtaggtaaagctgttgcagaa
cgcgctcttgaaaaaggcgtaactgcagttgcatttgatcgttctggtttccaataccac
ggtcgagtagcggcgctagcagaatctgctcgcgaagctggtctgaaattctaa
DBGET
integrated database retrieval system