KEGG   Vreelandella sp. SM1641: V8F66_00825
Entry
V8F66_00825       CDS       T11229                                 
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
vrs  Vreelandella sp. SM1641
Pathway
vrs03010  Ribosome
Brite
KEGG Orthology (KO) [BR:vrs00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    V8F66_00825 (rplR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:vrs03011]
    V8F66_00825 (rplR)
Ribosome [BR:vrs03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    V8F66_00825 (rplR)
  Bacteria
    V8F66_00825 (rplR)
  Archaea
    V8F66_00825 (rplR)
SSDB
Motif
Pfam: Ribosomal_L18p
Other DBs
NCBI-ProteinID: XBY59062
UniProt: A0AAU7XQ99
LinkDB
Position
168053..168403
AA seq 116 aa
MNAKKESRLRRARRARAKIRELGVYRLCVNRTPRHIYAQIISPDGGKVLASASTLDKALR
EGATGNSDAASKVGALIAERAKEAGITQVAFDRAGFKYHGRVKALADAAREGGLEF
NT seq 351 nt   +upstreamnt  +downstreamnt
atgaacgcgaagaaagaatctcgtctccgtcgtgcccgccgcgctcgcgcaaagatccgc
gagctgggcgtgtatcgcctgtgcgtcaaccgtaccccgcgtcacatctatgcgcagatt
atctcgccggatggtggcaaagtgctagccagtgcttctacgctggacaaagcactgcgc
gagggtgcgaccggtaactcagatgccgcctctaaagtaggtgctctgattgctgaacgc
gctaaagaagcaggcatcacccaggtggccttcgaccgtgctggctttaagtatcacggc
cgcgtcaaggcgctggccgacgccgcacgtgaaggcggcctggaattctaa

DBGET integrated database retrieval system