Vreelandella sp. SM1641: V8F66_04595 Help Entry V8F66_04595       CDS       T11229                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism vrs  Vreelandella sp. SM1641 Pathway vrs00261   Monobactam biosynthesis vrs01100   Metabolic pathways vrs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vrs00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     V8F66_04595  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:vrs01008]     V8F66_04595 Polyketide biosynthesis proteins [BR:vrs01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     V8F66_04595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  XBY59769 UniProt:  A0AAU7XPV3 LinkDB All DBs Position 965346..965591 Genome browser AA seq 81 aa AA seqDB search MTSCFDREDGVFRVLVNHEEQYSLWPEWKAIPAGWTDTGVLGDKPTCLDYVEKTWTDMRP LSLRQWMDAQAKSEAEQVDAG NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgacaagctgttttgatcgtgaagatggtgtcttccgcgtattagtcaaccacgaagag cagtactccctctggccagaatggaaagcgattcccgctggctggaccgataccggtgtg ctcggcgataagccaacctgcctcgactacgtcgaaaagacctggactgatatgcggcca ttgtcgctacgccagtggatggatgcgcaggccaaaagtgaggcggagcaggtggatgca ggttaa

DBGET integrated database retrieval system