Vreelandella sp. SM1641: V8F66_06255
Help
Entry
V8F66_06255 CDS
T11229
Name
(GenBank) pyridoxal phosphate-dependent aminotransferase
KO
K14260
alanine-synthesizing transaminase [EC:
2.6.1.66
2.6.1.2
]
Organism
vrs Vreelandella sp. SM1641
Pathway
vrs00220
Arginine biosynthesis
vrs00250
Alanine, aspartate and glutamate metabolism
vrs00290
Valine, leucine and isoleucine biosynthesis
vrs01100
Metabolic pathways
vrs01110
Biosynthesis of secondary metabolites
vrs01210
2-Oxocarboxylic acid metabolism
vrs01230
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:
vrs00001
]
09100 Metabolism
09105 Amino acid metabolism
00250 Alanine, aspartate and glutamate metabolism
V8F66_06255
00290 Valine, leucine and isoleucine biosynthesis
V8F66_06255
00220 Arginine biosynthesis
V8F66_06255
09180 Brite Hierarchies
09181 Protein families: metabolism
01007 Amino acid related enzymes [BR:
vrs01007
]
V8F66_06255
Enzymes [BR:
vrs01000
]
2. Transferases
2.6 Transferring nitrogenous groups
2.6.1 Transaminases
2.6.1.2 alanine transaminase
V8F66_06255
2.6.1.66 valine---pyruvate transaminase
V8F66_06255
Amino acid related enzymes [BR:
vrs01007
]
Aminotransferase (transaminase)
Class I
V8F66_06255
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Aminotran_1_2
DegT_DnrJ_EryC1
Beta_elim_lyase
Aminotran_5
Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID:
XBY60085
UniProt:
A0AAU7XRQ3
LinkDB
All DBs
Position
complement(1350374..1351621)
Genome browser
AA seq
415 aa
AA seq
DB search
MDTLQSHESQPLKKSHKLHNVCYDIRGPVLDHAKRLEEEGQRILKLNIGNPAPFGFEAPE
EILQDVMRNLPTAQGYCDSKGLYSARKAIMQECQRKQIPGVGIEDIFIGNGVSELIVMAM
QALLNDGDEVLIPAPDYPLWTAAAHLSGGHAVHYLCDEQADWTPDMADIRAKITSHTRAI
VLINPNNPTGAVYPPAVVKEVLAIAKQHNLVVFSDEIYDKILYDGVEHTATGALADDDQL
VITMNGLSKSYRCAGFRSGWMIISGNLAKLNAQDYIQGLNMLASMRLCANVPAQHAIQTA
LGGYQSINDLILPGGRLLAQRDITVEKLNAIPGVSCVKPKGALYAFPRLDPKVFNIKDDQ
QMVLDLLLQEKILLVQGTAFNWPEPDHVRIVTLPWADQLGDALDRFANFLSRYRQ
NT seq
1248 nt
NT seq
+upstream
nt +downstream
nt
atggataccctgcagtcgcacgaatcacaaccgttaaagaaatctcataagctgcacaat
gtctgctacgacattcgtggcccggtgctcgaccacgccaagcgcttggaagaggaaggc
caacgaattctcaagctgaatatcggcaaccccgcgcccttcggcttcgaggcgccggaa
gagattcttcaggatgtgatgcgtaacctaccaacggcccagggctactgcgattccaaa
ggtctctactccgcccgtaaagcgattatgcaggagtgccagcgcaagcagattcccggc
gtggggattgaggatatcttcatcggcaacggtgtgtctgagctgatcgtcatggccatg
caggcgctgctgaatgacggcgatgaggtactgattccagcgccggactacccgctatgg
accgcagccgctcacctttccggtggccacgcggtgcactacctgtgcgacgagcaggcc
gactggacgcctgacatggcggatattcgcgccaagatcaccagccacacgcgggccatt
gtgctgatcaaccccaacaacccgaccggcgcggtgtatccgcctgccgtggtgaaagag
gtgttggcgatcgccaagcagcataacctggtggtgttctctgacgagatctacgacaag
atcttgtatgacggcgtcgagcacaccgccacgggcgcgctggcggacgatgaccaatta
gtcatcaccatgaacgggctctccaaaagctatcgctgcgccggcttccgctcgggctgg
atgattatctccggcaacttggccaagctaaacgcccaggactatatccaggggctgaat
atgctggcttccatgcggctatgtgccaacgtgcccgcccagcacgcgattcaaaccgcg
ctggggggctatcaatcgatcaacgatttaatcctgcccggcgggcggctgctggcccag
cgcgatattaccgtggaaaagttgaatgcgatccccggggtttcctgcgtgaaaccgaaa
ggcgcgctgtacgcctttccgcggctcgaccccaaggtctttaatatcaaagacgaccag
cagatggtgctggatctgctgctgcaggaaaaaatattactggtacagggcactgccttt
aactggccagaacccgaccatgtgcgcattgtgacactgccctgggcagaccagctaggc
gatgcactcgaccgctttgccaatttcttgtcgcgctatcgccagtga
DBGET
integrated database retrieval system